Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 25386..25911 Replicon plasmid pEC0430-1
Accession NZ_CP123047
Organism Escherichia coli strain EC0430

Toxin (Protein)


Gene name ccdB Uniprot ID S1PFV8
Locus tag QDU34_RS23320 Protein ID WP_001159871.1
Coordinates 25606..25911 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID H9TJP1
Locus tag QDU34_RS23315 Protein ID WP_000813630.1
Coordinates 25386..25604 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDU34_RS23285 (20780) 20780..21196 - 417 WP_001034046.1 type II toxin-antitoxin system VapC family toxin -
QDU34_RS23290 (21193) 21193..21423 - 231 WP_001261278.1 type II toxin-antitoxin system VapB family antitoxin -
QDU34_RS23295 (21688) 21688..22188 + 501 WP_000528932.1 HEPN family nuclease -
QDU34_RS23300 (22201) 22201..22974 + 774 WP_000905949.1 hypothetical protein -
QDU34_RS23305 (23141) 23141..24274 + 1134 WP_000545987.1 DUF3800 domain-containing protein -
QDU34_RS23310 (24308) 24308..24796 - 489 WP_011254646.1 hypothetical protein -
QDU34_RS23315 (25386) 25386..25604 + 219 WP_000813630.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
QDU34_RS23320 (25606) 25606..25911 + 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB Toxin
QDU34_RS23325 (25912) 25912..26718 + 807 WP_280102451.1 site-specific integrase -
QDU34_RS23330 (27398) 27398..28129 - 732 WP_000504262.1 replication initiation protein -
QDU34_RS23335 (28750) 28750..29955 + 1206 WP_001442122.1 AAA family ATPase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sitABCD iucA / iucB / iucC / iucD / iutA / vat / iroN / iroE / iroD / iroC / iroB 1..207503 207503


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11692.49 Da        Isoelectric Point: 6.4674

>T278586 WP_001159871.1 NZ_CP123047:25606-25911 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8354.27 Da        Isoelectric Point: 4.5203

>AT278586 WP_000813630.1 NZ_CP123047:25386-25604 [Escherichia coli]
MKQRITVTVDSDSYQLLKAYDVNISGLVSTTLQNEARRLRAERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CCE8

Antitoxin

Source ID Structure
AlphaFold DB A0A829CEF5

References