Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 20780..21423 Replicon plasmid pEC0430-1
Accession NZ_CP123047
Organism Escherichia coli strain EC0430

Toxin (Protein)


Gene name vagD Uniprot ID C7S9Y5
Locus tag QDU34_RS23285 Protein ID WP_001034046.1
Coordinates 20780..21196 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID V0SR71
Locus tag QDU34_RS23290 Protein ID WP_001261278.1
Coordinates 21193..21423 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDU34_RS23270 (15917) 15917..16333 - 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin -
QDU34_RS23275 (16330) 16330..16560 - 231 WP_001261286.1 type II toxin-antitoxin system VapB family antitoxin -
QDU34_RS23280 (16941) 16941..20735 + 3795 WP_001144732.1 hypothetical protein -
QDU34_RS23285 (20780) 20780..21196 - 417 WP_001034046.1 type II toxin-antitoxin system VapC family toxin Toxin
QDU34_RS23290 (21193) 21193..21423 - 231 WP_001261278.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
QDU34_RS23295 (21688) 21688..22188 + 501 WP_000528932.1 HEPN family nuclease -
QDU34_RS23300 (22201) 22201..22974 + 774 WP_000905949.1 hypothetical protein -
QDU34_RS23305 (23141) 23141..24274 + 1134 WP_000545987.1 DUF3800 domain-containing protein -
QDU34_RS23310 (24308) 24308..24796 - 489 WP_011254646.1 hypothetical protein -
QDU34_RS23315 (25386) 25386..25604 + 219 WP_000813630.1 type II toxin-antitoxin system antitoxin CcdA -
QDU34_RS23320 (25606) 25606..25911 + 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sitABCD iucA / iucB / iucC / iucD / iutA / vat / iroN / iroE / iroD / iroC / iroB 1..207503 207503


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-53)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 14978.31 Da        Isoelectric Point: 6.7113

>T278585 WP_001034046.1 NZ_CP123047:c21196-20780 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8853.07 Da        Isoelectric Point: 4.6437

>AT278585 WP_001261278.1 NZ_CP123047:c21423-21193 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDRIILRPLRPSWSSFLELEKADPGFMTEREDVVCDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9NXF9

Antitoxin

Source ID Structure
AlphaFold DB V0SR71

References