Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 15917..16560 Replicon plasmid pEC0430-1
Accession NZ_CP123047
Organism Escherichia coli strain EC0430

Toxin (Protein)


Gene name vagD Uniprot ID V0UN72
Locus tag QDU34_RS23270 Protein ID WP_001034044.1
Coordinates 15917..16333 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID B1P7N7
Locus tag QDU34_RS23275 Protein ID WP_001261286.1
Coordinates 16330..16560 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDU34_RS23255 (12319) 12319..13016 + 698 WP_223155668.1 IS1-like element IS1A family transposase -
QDU34_RS23260 (13270) 13270..14292 - 1023 WP_032174242.1 helicase UvrD -
QDU34_RS23265 (14277) 14277..15842 - 1566 WP_001128474.1 AAA family ATPase -
QDU34_RS23270 (15917) 15917..16333 - 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin Toxin
QDU34_RS23275 (16330) 16330..16560 - 231 WP_001261286.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
QDU34_RS23280 (16941) 16941..20735 + 3795 WP_001144732.1 hypothetical protein -
QDU34_RS23285 (20780) 20780..21196 - 417 WP_001034046.1 type II toxin-antitoxin system VapC family toxin -
QDU34_RS23290 (21193) 21193..21423 - 231 WP_001261278.1 type II toxin-antitoxin system VapB family antitoxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sitABCD iucA / iucB / iucC / iucD / iutA / vat / iroN / iroE / iroD / iroC / iroB 1..207503 207503
- flank IS/Tn - - 12513..13016 503


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-52)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15232.66 Da        Isoelectric Point: 6.8536

>T278584 WP_001034044.1 NZ_CP123047:c16333-15917 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8747.86 Da        Isoelectric Point: 4.3775

>AT278584 WP_001261286.1 NZ_CP123047:c16560-16330 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFLELEKADPDFMTEREDVVSDEGRVNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CHW1

Antitoxin

Source ID Structure
AlphaFold DB A0A829CKZ6

References