Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 15917..16560 | Replicon | plasmid pEC0430-1 |
| Accession | NZ_CP123047 | ||
| Organism | Escherichia coli strain EC0430 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | V0UN72 |
| Locus tag | QDU34_RS23270 | Protein ID | WP_001034044.1 |
| Coordinates | 15917..16333 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | B1P7N7 |
| Locus tag | QDU34_RS23275 | Protein ID | WP_001261286.1 |
| Coordinates | 16330..16560 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDU34_RS23255 (12319) | 12319..13016 | + | 698 | WP_223155668.1 | IS1-like element IS1A family transposase | - |
| QDU34_RS23260 (13270) | 13270..14292 | - | 1023 | WP_032174242.1 | helicase UvrD | - |
| QDU34_RS23265 (14277) | 14277..15842 | - | 1566 | WP_001128474.1 | AAA family ATPase | - |
| QDU34_RS23270 (15917) | 15917..16333 | - | 417 | WP_001034044.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QDU34_RS23275 (16330) | 16330..16560 | - | 231 | WP_001261286.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| QDU34_RS23280 (16941) | 16941..20735 | + | 3795 | WP_001144732.1 | hypothetical protein | - |
| QDU34_RS23285 (20780) | 20780..21196 | - | 417 | WP_001034046.1 | type II toxin-antitoxin system VapC family toxin | - |
| QDU34_RS23290 (21193) | 21193..21423 | - | 231 | WP_001261278.1 | type II toxin-antitoxin system VapB family antitoxin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sitABCD | iucA / iucB / iucC / iucD / iutA / vat / iroN / iroE / iroD / iroC / iroB | 1..207503 | 207503 | |
| - | flank | IS/Tn | - | - | 12513..13016 | 503 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15232.66 Da Isoelectric Point: 6.8536
>T278584 WP_001034044.1 NZ_CP123047:c16333-15917 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CHW1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CKZ6 |