Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
Location | 4249492..4250087 | Replicon | chromosome |
Accession | NZ_CP123046 | ||
Organism | Escherichia coli strain EC0430 |
Toxin (Protein)
Gene name | chpB | Uniprot ID | U9Y4M4 |
Locus tag | QDU34_RS20475 | Protein ID | WP_000239579.1 |
Coordinates | 4249492..4249842 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | chpS | Uniprot ID | A0A4D0VVQ9 |
Locus tag | QDU34_RS20480 | Protein ID | WP_001223207.1 |
Coordinates | 4249836..4250087 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDU34_RS20455 (4244768) | 4244768..4245790 | - | 1023 | WP_001296689.1 | ABC transporter permease | - |
QDU34_RS20460 (4245804) | 4245804..4247306 | - | 1503 | WP_000205795.1 | sugar ABC transporter ATP-binding protein | - |
QDU34_RS20465 (4247616) | 4247616..4248572 | - | 957 | WP_000265933.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
QDU34_RS20470 (4248882) | 4248882..4249412 | + | 531 | WP_000055072.1 | inorganic diphosphatase | - |
QDU34_RS20475 (4249492) | 4249492..4249842 | - | 351 | WP_000239579.1 | endoribonuclease toxin ChpB | Toxin |
QDU34_RS20480 (4249836) | 4249836..4250087 | - | 252 | WP_001223207.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
QDU34_RS20485 (4250300) | 4250300..4250641 | - | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
QDU34_RS20490 (4250644) | 4250644..4254423 | - | 3780 | WP_000060927.1 | autotransporter assembly complex protein TamB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12511.45 Da Isoelectric Point: 5.6219
>T278581 WP_000239579.1 NZ_CP123046:c4249842-4249492 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0Y8A8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4D0VVQ9 |