Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
| Location | 3555525..3556362 | Replicon | chromosome |
| Accession | NZ_CP123046 | ||
| Organism | Escherichia coli strain EC0430 | ||
Toxin (Protein)
| Gene name | itaT | Uniprot ID | Q3Z4X7 |
| Locus tag | QDU34_RS17205 | Protein ID | WP_000227784.1 |
| Coordinates | 3555820..3556362 (+) | Length | 181 a.a. |
Antitoxin (Protein)
| Gene name | itaR | Uniprot ID | I2UQS9 |
| Locus tag | QDU34_RS17200 | Protein ID | WP_001297137.1 |
| Coordinates | 3555525..3555836 (+) | Length | 104 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDU34_RS17175 (3550545) | 3550545..3551492 | + | 948 | WP_001239441.1 | cytochrome o ubiquinol oxidase subunit II | - |
| QDU34_RS17180 (3551514) | 3551514..3553505 | + | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
| QDU34_RS17185 (3553495) | 3553495..3554109 | + | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
| QDU34_RS17190 (3554109) | 3554109..3554438 | + | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
| QDU34_RS17195 (3554450) | 3554450..3555340 | + | 891 | WP_000971336.1 | heme o synthase | - |
| QDU34_RS17200 (3555525) | 3555525..3555836 | + | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
| QDU34_RS17205 (3555820) | 3555820..3556362 | + | 543 | WP_000227784.1 | GNAT family N-acetyltransferase | Toxin |
| QDU34_RS17210 (3556418) | 3556418..3557353 | - | 936 | WP_001297127.1 | tetratricopeptide repeat protein | - |
| QDU34_RS17215 (3557761) | 3557761..3559125 | + | 1365 | WP_001000975.1 | MFS transporter | - |
| QDU34_RS17220 (3559253) | 3559253..3559744 | - | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
| QDU34_RS17225 (3559912) | 3559912..3560823 | + | 912 | WP_000705877.1 | 2-dehydropantoate 2-reductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19805.02 Da Isoelectric Point: 8.3395
>T278578 WP_000227784.1 NZ_CP123046:3555820-3556362 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|