Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1339007..1339632 | Replicon | chromosome |
Accession | NZ_CP123046 | ||
Organism | Escherichia coli strain EC0430 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | QDU34_RS06535 | Protein ID | WP_000911330.1 |
Coordinates | 1339234..1339632 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | U9XQV3 |
Locus tag | QDU34_RS06530 | Protein ID | WP_000450524.1 |
Coordinates | 1339007..1339234 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDU34_RS06505 (1334810) | 1334810..1335280 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
QDU34_RS06510 (1335280) | 1335280..1335852 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
QDU34_RS06515 (1335998) | 1335998..1336876 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
QDU34_RS06520 (1336893) | 1336893..1337927 | + | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
QDU34_RS06525 (1338140) | 1338140..1338853 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
QDU34_RS06530 (1339007) | 1339007..1339234 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
QDU34_RS06535 (1339234) | 1339234..1339632 | + | 399 | WP_000911330.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QDU34_RS06540 (1339779) | 1339779..1340642 | + | 864 | WP_001267507.1 | neutral zinc metallopeptidase | - |
QDU34_RS06545 (1340657) | 1340657..1342672 | + | 2016 | WP_000829323.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
QDU34_RS06550 (1342746) | 1342746..1343444 | + | 699 | WP_000679823.1 | esterase | - |
QDU34_RS06555 (1343554) | 1343554..1343754 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14894.25 Da Isoelectric Point: 9.2216
>T278570 WP_000911330.1 NZ_CP123046:1339234-1339632 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|