Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 73160..73685 Replicon plasmid pKP161637-1
Accession NZ_CP123044
Organism Klebsiella pneumoniae strain KP161637

Toxin (Protein)


Gene name ccdB Uniprot ID D4HQE7
Locus tag QDF61_RS26775 Protein ID WP_013023785.1
Coordinates 73380..73685 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID W8V2V6
Locus tag QDF61_RS26770 Protein ID WP_001568025.1
Coordinates 73160..73378 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDF61_RS26750 (QDF61_26750) 68316..69095 + 780 WP_013023780.1 hypothetical protein -
QDF61_RS26755 (QDF61_26755) 69302..70894 + 1593 WP_015344964.1 hypothetical protein -
QDF61_RS26760 (QDF61_26760) 70928..72055 + 1128 WP_013023782.1 DUF4238 domain-containing protein -
QDF61_RS26765 (QDF61_26765) 72052..72342 + 291 WP_013023783.1 hypothetical protein -
QDF61_RS26770 (QDF61_26770) 73160..73378 + 219 WP_001568025.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
QDF61_RS26775 (QDF61_26775) 73380..73685 + 306 WP_013023785.1 type II toxin-antitoxin system toxin CcdB Toxin
QDF61_RS26780 (QDF61_26780) 73854..74249 + 396 WP_017899885.1 hypothetical protein -
QDF61_RS26785 (QDF61_26785) 74276..74590 + 315 WP_053389906.1 hypothetical protein -
QDF61_RS26790 (QDF61_26790) 74601..75617 + 1017 WP_017899884.1 hypothetical protein -
QDF61_RS26795 (QDF61_26795) 75815..76609 + 795 WP_004197635.1 site-specific integrase -
QDF61_RS26800 (QDF61_26800) 77017..77319 - 303 WP_004197636.1 hypothetical protein -
QDF61_RS26805 (QDF61_26805) 77316..77942 - 627 WP_004197649.1 ParA family plasmid-partitioning AAA ATPase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid qnrS1 / blaCTX-M-3 / blaTEM-1B / floR / tet(A) / sul2 / aph(3'')-Ib / aph(6)-Id - 1..118619 118619


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11615.30 Da        Isoelectric Point: 6.4672

>T278564 WP_013023785.1 NZ_CP123044:73380-73685 [Klebsiella pneumoniae]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8392.34 Da        Isoelectric Point: 4.7405

>AT278564 WP_001568025.1 NZ_CP123044:73160-73378 [Klebsiella pneumoniae]
MKQRITVTIDSDSYQLLKSADVNISALVNRAMQNEARRLRSERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2J4ZZW6

Antitoxin

Source ID Structure
AlphaFold DB A0A2J4ZZP8

References