Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4876263..4876779 | Replicon | chromosome |
Accession | NZ_CP123043 | ||
Organism | Klebsiella pneumoniae strain KP161637 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A2A2BGN7 |
Locus tag | QDF61_RS23685 | Protein ID | WP_009486548.1 |
Coordinates | 4876263..4876547 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | QDF61_RS23690 | Protein ID | WP_002886901.1 |
Coordinates | 4876537..4876779 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDF61_RS23660 (4871659) | 4871659..4871922 | - | 264 | WP_004152271.1 | PTS sugar transporter subunit IIB | - |
QDF61_RS23665 (4872052) | 4872052..4872225 | + | 174 | WP_004222159.1 | hypothetical protein | - |
QDF61_RS23670 (4872228) | 4872228..4872971 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
QDF61_RS23675 (4873328) | 4873328..4875466 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
QDF61_RS23680 (4875795) | 4875795..4876259 | + | 465 | WP_002886903.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
QDF61_RS23685 (4876263) | 4876263..4876547 | - | 285 | WP_009486548.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QDF61_RS23690 (4876537) | 4876537..4876779 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
QDF61_RS23695 (4876857) | 4876857..4878766 | - | 1910 | Protein_4647 | PRD domain-containing protein | - |
QDF61_RS23700 (4878789) | 4878789..4879943 | - | 1155 | WP_004178372.1 | lactonase family protein | - |
QDF61_RS23705 (4880010) | 4880010..4880750 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11125.95 Da Isoelectric Point: 10.4951
>T278561 WP_009486548.1 NZ_CP123043:c4876547-4876263 [Klebsiella pneumoniae]
MTYELEFDPRARREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRARREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2A2BGN7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GLP0 |