Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 36871..37396 Replicon plasmid pKP160802-1
Accession NZ_CP123041
Organism Klebsiella pneumoniae strain KP160802

Toxin (Protein)


Gene name ccdB Uniprot ID D4HQE7
Locus tag QDE57_RS26315 Protein ID WP_013023785.1
Coordinates 37091..37396 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID W8V2V6
Locus tag QDE57_RS26310 Protein ID WP_001568025.1
Coordinates 36871..37089 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDE57_RS26290 (QDE57_26290) 32027..32806 + 780 WP_013023780.1 hypothetical protein -
QDE57_RS26295 (QDE57_26295) 33013..34605 + 1593 WP_015344964.1 hypothetical protein -
QDE57_RS26300 (QDE57_26300) 34639..35766 + 1128 WP_013023782.1 DUF4238 domain-containing protein -
QDE57_RS26305 (QDE57_26305) 35763..36053 + 291 WP_013023783.1 hypothetical protein -
QDE57_RS26310 (QDE57_26310) 36871..37089 + 219 WP_001568025.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
QDE57_RS26315 (QDE57_26315) 37091..37396 + 306 WP_013023785.1 type II toxin-antitoxin system toxin CcdB Toxin
QDE57_RS26320 (QDE57_26320) 37565..37960 + 396 WP_017899885.1 hypothetical protein -
QDE57_RS26325 (QDE57_26325) 37987..38301 + 315 WP_053389906.1 hypothetical protein -
QDE57_RS26330 (QDE57_26330) 38312..39328 + 1017 WP_017899884.1 hypothetical protein -
QDE57_RS26335 (QDE57_26335) 39526..40320 + 795 WP_004197635.1 site-specific integrase -
QDE57_RS26340 (QDE57_26340) 40728..41030 - 303 WP_004197636.1 hypothetical protein -
QDE57_RS26345 (QDE57_26345) 41027..41653 - 627 WP_004197649.1 ParA family plasmid-partitioning AAA ATPase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaCTX-M-3 / blaTEM-1B / floR / tet(A) / sul2 / aph(3'')-Ib / aph(6)-Id / qnrS1 - 1..118619 118619


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11615.30 Da        Isoelectric Point: 6.4672

>T278550 WP_013023785.1 NZ_CP123041:37091-37396 [Klebsiella pneumoniae]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8392.34 Da        Isoelectric Point: 4.7405

>AT278550 WP_001568025.1 NZ_CP123041:36871-37089 [Klebsiella pneumoniae]
MKQRITVTIDSDSYQLLKSADVNISALVNRAMQNEARRLRSERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2J4ZZW6

Antitoxin

Source ID Structure
AlphaFold DB A0A2J4ZZP8

References