Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4820605..4821121 | Replicon | chromosome |
| Accession | NZ_CP123040 | ||
| Organism | Klebsiella pneumoniae strain KP160802 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A2A2BGN7 |
| Locus tag | QDE57_RS23415 | Protein ID | WP_009486548.1 |
| Coordinates | 4820605..4820889 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | R4Y888 |
| Locus tag | QDE57_RS23420 | Protein ID | WP_002886901.1 |
| Coordinates | 4820879..4821121 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDE57_RS23390 (4816001) | 4816001..4816264 | - | 264 | WP_004152271.1 | PTS sugar transporter subunit IIB | - |
| QDE57_RS23395 (4816394) | 4816394..4816567 | + | 174 | WP_004222159.1 | hypothetical protein | - |
| QDE57_RS23400 (4816570) | 4816570..4817313 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
| QDE57_RS23405 (4817670) | 4817670..4819808 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| QDE57_RS23410 (4820137) | 4820137..4820601 | + | 465 | WP_002886903.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| QDE57_RS23415 (4820605) | 4820605..4820889 | - | 285 | WP_009486548.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QDE57_RS23420 (4820879) | 4820879..4821121 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| QDE57_RS23425 (4821199) | 4821199..4823108 | - | 1910 | Protein_4593 | PRD domain-containing protein | - |
| QDE57_RS23430 (4823131) | 4823131..4824285 | - | 1155 | WP_004178372.1 | lactonase family protein | - |
| QDE57_RS23435 (4824352) | 4824352..4825092 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11125.95 Da Isoelectric Point: 10.4951
>T278547 WP_009486548.1 NZ_CP123040:c4820889-4820605 [Klebsiella pneumoniae]
MTYELEFDPRARREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRARREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2A2BGN7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GLP0 |