Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4104037..4104656 Replicon chromosome
Accession NZ_CP123040
Organism Klebsiella pneumoniae strain KP160802

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag QDE57_RS19980 Protein ID WP_002892050.1
Coordinates 4104438..4104656 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag QDE57_RS19975 Protein ID WP_002892066.1
Coordinates 4104037..4104411 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDE57_RS19965 (4099189) 4099189..4100382 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
QDE57_RS19970 (4100405) 4100405..4103551 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
QDE57_RS19975 (4104037) 4104037..4104411 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
QDE57_RS19980 (4104438) 4104438..4104656 + 219 WP_002892050.1 HHA domain-containing protein Toxin
QDE57_RS19985 (4104815) 4104815..4105381 + 567 WP_002892030.1 maltose O-acetyltransferase -
QDE57_RS19990 (4105353) 4105353..4105493 - 141 WP_004147370.1 hypothetical protein -
QDE57_RS19995 (4105514) 4105514..4105984 + 471 WP_002892026.1 YlaC family protein -
QDE57_RS20000 (4105959) 4105959..4107410 - 1452 WP_004177237.1 PLP-dependent aminotransferase family protein -
QDE57_RS20005 (4107511) 4107511..4108209 + 699 WP_004177238.1 GNAT family protein -
QDE57_RS20010 (4108206) 4108206..4108346 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
QDE57_RS20015 (4108346) 4108346..4108609 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T278545 WP_002892050.1 NZ_CP123040:4104438-4104656 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT278545 WP_002892066.1 NZ_CP123040:4104037-4104411 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References