Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 93332..93975 | Replicon | plasmid pE22P1 |
Accession | NZ_CP123037 | ||
Organism | Escherichia coli strain E22 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | B1LRW4 |
Locus tag | QEN54_RS23920 | Protein ID | WP_001044768.1 |
Coordinates | 93559..93975 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | D2WFK3 |
Locus tag | QEN54_RS23915 | Protein ID | WP_001261287.1 |
Coordinates | 93332..93562 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QEN54_RS23905 (88510) | 88510..89643 | - | 1134 | WP_000545983.1 | DUF3800 domain-containing protein | - |
QEN54_RS23910 (89906) | 89906..93025 | - | 3120 | WP_023909028.1 | hypothetical protein | - |
QEN54_RS23915 (93332) | 93332..93562 | + | 231 | WP_001261287.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
QEN54_RS23920 (93559) | 93559..93975 | + | 417 | WP_001044768.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QEN54_RS23925 (94137) | 94137..96275 | - | 2139 | WP_000350635.1 | AAA family ATPase | - |
QEN54_RS23930 (96740) | 96740..97735 | + | 996 | WP_000246636.1 | hypothetical protein | - |
QEN54_RS23935 (97778) | 97778..98671 | + | 894 | WP_001553853.1 | S-4TM family putative pore-forming effector | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | tet(B) / sul1 / aadA2 / dfrA12 / blaTEM-1B / sul2 / aph(3'')-Ib / aph(6)-Id / mph(A) / aac(3)-IId / aadA5 / blaNDM-5 / blaCTX-M-15 / blaOXA-1 / aac(6')-Ib-cr | - | 1..108280 | 108280 | |
- | flank | IS/Tn | - | - | 98808..99185 | 377 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15197.66 Da Isoelectric Point: 7.7805
>T278536 WP_001044768.1 NZ_CP123037:93559-93975 [Escherichia coli]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A606Q844 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QFC4 |