Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 86853..87378 | Replicon | plasmid pE22P1 |
Accession | NZ_CP123037 | ||
Organism | Escherichia coli strain E22 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | V0SSI5 |
Locus tag | QEN54_RS23885 | Protein ID | WP_001159868.1 |
Coordinates | 86853..87158 (-) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | A0A223LLB0 |
Locus tag | QEN54_RS23890 | Protein ID | WP_023909027.1 |
Coordinates | 87160..87378 (-) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QEN54_RS23870 (82763) | 82763..83929 | - | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
QEN54_RS23875 (84517) | 84517..85272 | - | 756 | WP_000852146.1 | replication initiation protein RepE | - |
QEN54_RS23880 (86046) | 86046..86852 | - | 807 | WP_000016982.1 | site-specific integrase | - |
QEN54_RS23885 (86853) | 86853..87158 | - | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
QEN54_RS23890 (87160) | 87160..87378 | - | 219 | WP_023909027.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
QEN54_RS23895 (88012) | 88012..88209 | + | 198 | WP_000215657.1 | hypothetical protein | - |
QEN54_RS23900 (88206) | 88206..88490 | - | 285 | WP_000642771.1 | hypothetical protein | - |
QEN54_RS23905 (88510) | 88510..89643 | - | 1134 | WP_000545983.1 | DUF3800 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | tet(B) / sul1 / aadA2 / dfrA12 / blaTEM-1B / sul2 / aph(3'')-Ib / aph(6)-Id / mph(A) / aac(3)-IId / aadA5 / blaNDM-5 / blaCTX-M-15 / blaOXA-1 / aac(6')-Ib-cr | - | 1..108280 | 108280 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T278535 WP_001159868.1 NZ_CP123037:c87158-86853 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|