Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 2889596..2890440 Replicon chromosome
Accession NZ_CP123036
Organism Escherichia coli strain E22

Toxin (Protein)


Gene name yeeV Uniprot ID B1LJY4
Locus tag QEN54_RS14095 Protein ID WP_000854686.1
Coordinates 2889596..2889979 (-) Length 128 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A8E0J1S3
Locus tag QEN54_RS14100 Protein ID WP_001285602.1
Coordinates 2890060..2890440 (-) Length 127 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QEN54_RS14055 (2884599) 2884599..2885090 - 492 WP_001297187.1 DUF1097 domain-containing protein -
QEN54_RS14060 (2885192) 2885192..2885746 - 555 WP_001001902.1 molecular chaperone YcdY -
QEN54_RS14065 (2885770) 2885770..2886507 - 738 WP_000283664.1 zinc-binding phosphatase -
QEN54_RS14070 (2886562) 2886562..2887500 - 939 WP_000351311.1 glyoxylate/hydroxypyruvate reductase GhrA -
QEN54_RS14080 (2887971) 2887971..2888812 - 842 Protein_2761 DUF4942 domain-containing protein -
QEN54_RS14085 (2888897) 2888897..2889094 - 198 WP_000839253.1 DUF957 domain-containing protein -
QEN54_RS14090 (2889111) 2889111..2889599 - 489 WP_032180032.1 DUF5983 family protein -
QEN54_RS14095 (2889596) 2889596..2889979 - 384 WP_000854686.1 TA system toxin CbtA family protein Toxin
QEN54_RS14100 (2890060) 2890060..2890440 - 381 WP_001285602.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QEN54_RS14105 (2890451) 2890451..2891134 - 684 WP_000086768.1 hypothetical protein -
QEN54_RS14110 (2891153) 2891153..2891374 - 222 WP_000692298.1 DUF987 domain-containing protein -
QEN54_RS14115 (2891437) 2891437..2891913 - 477 WP_001186726.1 RadC family protein -
QEN54_RS14120 (2891929) 2891929..2892414 - 486 WP_000214307.1 antirestriction protein -
QEN54_RS14125 (2892506) 2892506..2893327 - 822 WP_001761104.1 DUF932 domain-containing protein -
QEN54_RS14130 (2893428) 2893428..2893636 - 209 Protein_2771 DUF905 family protein -
QEN54_RS14135 (2893737) 2893737..2894192 - 456 WP_000581506.1 IrmA family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island blaCMY-2 csgB / csgD / csgE / csgF / csgG 2880981..2936947 55966


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-113)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 128 a.a.        Molecular weight: 14272.28 Da        Isoelectric Point: 6.8614

>T278527 WP_000854686.1 NZ_CP123036:c2889979-2889596 [Escherichia coli]
MKTLPDTHVRAASRCPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYVLVRTDQPGF
SAGAPSSQLINSIDILRARRATGLMTRDNYRMVNNITLGKHPEEAKQ

Download         Length: 384 bp

Antitoxin


Download         Length: 127 a.a.        Molecular weight: 13938.69 Da        Isoelectric Point: 5.0823

>AT278527 WP_001285602.1 NZ_CP123036:c2890440-2890060 [Escherichia coli]
VSDTLPGTTLPDDNKDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE

Download         Length: 381 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References