Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 1870951..1871783 | Replicon | chromosome |
| Accession | NZ_CP123036 | ||
| Organism | Escherichia coli strain E22 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0Q2Y5N3 |
| Locus tag | QEN54_RS09005 | Protein ID | WP_001514886.1 |
| Coordinates | 1870951..1871325 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A7U9IW59 |
| Locus tag | QEN54_RS09010 | Protein ID | WP_001360327.1 |
| Coordinates | 1871415..1871783 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QEN54_RS08970 (1866467) | 1866467..1866940 | + | 474 | WP_001105385.1 | DNA gyrase inhibitor SbmC | - |
| QEN54_RS08975 (1867139) | 1867139..1868197 | + | 1059 | WP_032181141.1 | FUSC family protein | - |
| QEN54_RS08980 (1868369) | 1868369..1868698 | + | 330 | WP_000450409.1 | DUF496 family protein | - |
| QEN54_RS08985 (1868799) | 1868799..1869065 | - | 267 | WP_063121129.1 | EutP/PduV family microcompartment system protein | - |
| QEN54_RS08990 (1869435) | 1869435..1869806 | - | 372 | WP_001295631.1 | IS110 family transposase | - |
| QEN54_RS08995 (1870622) | 1870622..1870702 | - | 81 | Protein_1760 | hypothetical protein | - |
| QEN54_RS09000 (1870802) | 1870802..1870954 | - | 153 | Protein_1761 | DUF5983 family protein | - |
| QEN54_RS09005 (1870951) | 1870951..1871325 | - | 375 | WP_001514886.1 | TA system toxin CbtA family protein | Toxin |
| QEN54_RS09010 (1871415) | 1871415..1871783 | - | 369 | WP_001360327.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QEN54_RS09015 (1871946) | 1871946..1872167 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| QEN54_RS09020 (1872230) | 1872230..1872706 | - | 477 | WP_001186747.1 | RadC family protein | - |
| QEN54_RS09025 (1872722) | 1872722..1873195 | - | 474 | WP_000855059.1 | antirestriction protein | - |
| QEN54_RS09030 (1873537) | 1873537..1874355 | - | 819 | WP_088540043.1 | DUF932 domain-containing protein | - |
| QEN54_RS09035 (1874473) | 1874473..1874668 | - | 196 | Protein_1768 | DUF905 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13930.91 Da Isoelectric Point: 7.2909
>T278521 WP_001514886.1 NZ_CP123036:c1871325-1870951 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQSGF
SAGASSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAK
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQSGF
SAGASSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13593.34 Da Isoelectric Point: 5.9598
>AT278521 WP_001360327.1 NZ_CP123036:c1871783-1871415 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0Q2Y5N3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9IW59 |