Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 69196..69839 | Replicon | plasmid p20-20P2 |
| Accession | NZ_CP123031 | ||
| Organism | Escherichia coli strain 20-20 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | B1LRW4 |
| Locus tag | QEN57_RS24065 | Protein ID | WP_001044768.1 |
| Coordinates | 69423..69839 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | D2WFK3 |
| Locus tag | QEN57_RS24060 | Protein ID | WP_001261287.1 |
| Coordinates | 69196..69426 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QEN57_RS24050 (64374) | 64374..65507 | - | 1134 | WP_000545983.1 | DUF3800 domain-containing protein | - |
| QEN57_RS24055 (65770) | 65770..68889 | - | 3120 | WP_023909028.1 | hypothetical protein | - |
| QEN57_RS24060 (69196) | 69196..69426 | + | 231 | WP_001261287.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| QEN57_RS24065 (69423) | 69423..69839 | + | 417 | WP_001044768.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QEN57_RS24070 (70001) | 70001..72139 | - | 2139 | WP_000350635.1 | AAA family ATPase | - |
| QEN57_RS24075 (72604) | 72604..73599 | + | 996 | WP_000246636.1 | hypothetical protein | - |
| QEN57_RS24080 (73642) | 73642..74535 | + | 894 | WP_001553853.1 | S-4TM family putative pore-forming effector | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | tet(B) / sul1 / qacE / aadA2 / dfrA12 / blaNDM-5 / blaTEM-1B / blaCTX-M-15 / blaOXA-1 / aac(6')-Ib-cr | - | 1..84132 | 84132 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15197.66 Da Isoelectric Point: 7.7805
>T278510 WP_001044768.1 NZ_CP123031:69423-69839 [Escherichia coli]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A606Q844 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QFC4 |