Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 62717..63242 | Replicon | plasmid p20-20P2 |
Accession | NZ_CP123031 | ||
Organism | Escherichia coli strain 20-20 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | V0SSI5 |
Locus tag | QEN57_RS24030 | Protein ID | WP_001159868.1 |
Coordinates | 62717..63022 (-) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | A0A223LLB0 |
Locus tag | QEN57_RS24035 | Protein ID | WP_023909027.1 |
Coordinates | 63024..63242 (-) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QEN57_RS24015 (58627) | 58627..59793 | - | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
QEN57_RS24020 (60381) | 60381..61136 | - | 756 | WP_000852146.1 | replication initiation protein RepE | - |
QEN57_RS24025 (61910) | 61910..62716 | - | 807 | WP_000016982.1 | site-specific integrase | - |
QEN57_RS24030 (62717) | 62717..63022 | - | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
QEN57_RS24035 (63024) | 63024..63242 | - | 219 | WP_023909027.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
QEN57_RS24040 (63876) | 63876..64073 | + | 198 | WP_000215657.1 | hypothetical protein | - |
QEN57_RS24045 (64070) | 64070..64354 | - | 285 | WP_000642771.1 | hypothetical protein | - |
QEN57_RS24050 (64374) | 64374..65507 | - | 1134 | WP_000545983.1 | DUF3800 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | tet(B) / sul1 / qacE / aadA2 / dfrA12 / blaNDM-5 / blaTEM-1B / blaCTX-M-15 / blaOXA-1 / aac(6')-Ib-cr | - | 1..84132 | 84132 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T278509 WP_001159868.1 NZ_CP123031:c63022-62717 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|