Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 65684..66285 Replicon plasmid p20-20P1
Accession NZ_CP123030
Organism Escherichia coli strain 20-20

Toxin (Protein)


Gene name doc Uniprot ID U9YA20
Locus tag QEN57_RS23475 Protein ID WP_001216045.1
Coordinates 65905..66285 (+) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag QEN57_RS23470 Protein ID WP_001190712.1
Coordinates 65684..65905 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QEN57_RS23440 61083..61376 + 294 WP_000269004.1 hypothetical protein -
QEN57_RS23445 61383..61757 + 375 WP_023356289.1 hypothetical protein -
QEN57_RS23450 61739..62671 + 933 WP_104989460.1 hypothetical protein -
QEN57_RS23455 62668..63030 + 363 WP_001261543.1 hypothetical protein -
QEN57_RS23460 64463..65047 - 585 WP_104989459.1 DNA-binding protein -
QEN57_RS23465 65222..65611 + 390 WP_000506730.1 S24 family peptidase -
QEN57_RS23470 65684..65905 + 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QEN57_RS23475 65905..66285 + 381 WP_001216045.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
QEN57_RS23480 66290..66469 + 180 WP_001339207.1 hypothetical protein -
QEN57_RS23485 66497..67540 + 1044 WP_023356283.1 DUF968 domain-containing protein -
QEN57_RS23490 67629..68081 + 453 WP_001326849.1 late promoter-activating protein -
QEN57_RS23495 68167..69360 + 1194 WP_000219625.1 hypothetical protein -
QEN57_RS23500 69402..70844 + 1443 WP_001472843.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..107778 107778


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(3-120)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13588.29 Da        Isoelectric Point: 5.1514

>T278504 WP_001216045.1 NZ_CP123030:65905-66285 [Escherichia coli]
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT278504 WP_001190712.1 NZ_CP123030:65684-65905 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CLP7

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References