Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 2867337..2868181 Replicon chromosome
Accession NZ_CP123029
Organism Escherichia coli strain 20-20

Toxin (Protein)


Gene name yeeV Uniprot ID B1LJY4
Locus tag QEN57_RS13950 Protein ID WP_000854686.1
Coordinates 2867337..2867720 (-) Length 128 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A8E0J1S3
Locus tag QEN57_RS13955 Protein ID WP_001285602.1
Coordinates 2867801..2868181 (-) Length 127 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QEN57_RS13910 (2862340) 2862340..2862831 - 492 WP_001297187.1 DUF1097 domain-containing protein -
QEN57_RS13915 (2862933) 2862933..2863487 - 555 WP_001001902.1 molecular chaperone YcdY -
QEN57_RS13920 (2863511) 2863511..2864248 - 738 WP_000283664.1 zinc-binding phosphatase -
QEN57_RS13925 (2864303) 2864303..2865241 - 939 WP_000351311.1 glyoxylate/hydroxypyruvate reductase GhrA -
QEN57_RS13935 (2865712) 2865712..2866553 - 842 Protein_2731 DUF4942 domain-containing protein -
QEN57_RS13940 (2866638) 2866638..2866835 - 198 WP_000839253.1 DUF957 domain-containing protein -
QEN57_RS13945 (2866852) 2866852..2867340 - 489 WP_032180032.1 DUF5983 family protein -
QEN57_RS13950 (2867337) 2867337..2867720 - 384 WP_000854686.1 TA system toxin CbtA family protein Toxin
QEN57_RS13955 (2867801) 2867801..2868181 - 381 WP_001285602.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QEN57_RS13960 (2868192) 2868192..2868875 - 684 WP_000086768.1 hypothetical protein -
QEN57_RS13965 (2868894) 2868894..2869115 - 222 WP_000692298.1 DUF987 domain-containing protein -
QEN57_RS13970 (2869178) 2869178..2869654 - 477 WP_001186726.1 RadC family protein -
QEN57_RS13975 (2869670) 2869670..2870155 - 486 WP_000214307.1 antirestriction protein -
QEN57_RS13980 (2870247) 2870247..2871068 - 822 WP_001761104.1 DUF932 domain-containing protein -
QEN57_RS13985 (2871169) 2871169..2871377 - 209 Protein_2741 DUF905 family protein -
QEN57_RS13990 (2871478) 2871478..2871933 - 456 WP_000581506.1 IrmA family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-113)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 128 a.a.        Molecular weight: 14272.28 Da        Isoelectric Point: 6.8614

>T278500 WP_000854686.1 NZ_CP123029:c2867720-2867337 [Escherichia coli]
MKTLPDTHVRAASRCPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYVLVRTDQPGF
SAGAPSSQLINSIDILRARRATGLMTRDNYRMVNNITLGKHPEEAKQ

Download         Length: 384 bp

Antitoxin


Download         Length: 127 a.a.        Molecular weight: 13938.69 Da        Isoelectric Point: 5.0823

>AT278500 WP_001285602.1 NZ_CP123029:c2868181-2867801 [Escherichia coli]
VSDTLPGTTLPDDNKDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE

Download         Length: 381 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References