Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1847263..1848095 Replicon chromosome
Accession NZ_CP123029
Organism Escherichia coli strain 20-20

Toxin (Protein)


Gene name yeeV Uniprot ID A0A0Q2Y5N3
Locus tag QEN57_RS08855 Protein ID WP_001514886.1
Coordinates 1847263..1847637 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A7U9IW59
Locus tag QEN57_RS08860 Protein ID WP_001360327.1
Coordinates 1847727..1848095 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QEN57_RS08820 (1842779) 1842779..1843252 + 474 WP_001105385.1 DNA gyrase inhibitor SbmC -
QEN57_RS08825 (1843451) 1843451..1844509 + 1059 WP_032181141.1 FUSC family protein -
QEN57_RS08830 (1844681) 1844681..1845010 + 330 WP_000450409.1 DUF496 family protein -
QEN57_RS08835 (1845111) 1845111..1845377 - 267 WP_063121129.1 EutP/PduV family microcompartment system protein -
QEN57_RS08840 (1845747) 1845747..1846118 - 372 WP_001295631.1 IS110 family transposase -
QEN57_RS08845 (1846934) 1846934..1847014 - 81 Protein_1730 hypothetical protein -
QEN57_RS08850 (1847114) 1847114..1847266 - 153 Protein_1731 DUF5983 family protein -
QEN57_RS08855 (1847263) 1847263..1847637 - 375 WP_001514886.1 TA system toxin CbtA family protein Toxin
QEN57_RS08860 (1847727) 1847727..1848095 - 369 WP_001360327.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QEN57_RS08865 (1848258) 1848258..1848479 - 222 WP_000692286.1 DUF987 domain-containing protein -
QEN57_RS08870 (1848542) 1848542..1849018 - 477 WP_001186774.1 RadC family protein -
QEN57_RS08875 (1849034) 1849034..1849507 - 474 WP_000855059.1 antirestriction protein -
QEN57_RS08880 (1849849) 1849849..1850667 - 819 WP_088540043.1 DUF932 domain-containing protein -
QEN57_RS08885 (1850785) 1850785..1850953 - 169 Protein_1738 DUF905 family protein -
QEN57_RS08890 (1851039) 1851039..1851785 - 747 WP_053906593.1 IS21-like element ISEc12 family helper ATPase IstB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1820922..1856484 35562
- inside Prophage - - 1820922..1883094 62172


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13930.91 Da        Isoelectric Point: 7.2909

>T278494 WP_001514886.1 NZ_CP123029:c1847637-1847263 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQSGF
SAGASSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13593.34 Da        Isoelectric Point: 5.9598

>AT278494 WP_001360327.1 NZ_CP123029:c1848095-1847727 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0Q2Y5N3

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9IW59

References