Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1320531..1321156 | Replicon | chromosome |
Accession | NZ_CP123029 | ||
Organism | Escherichia coli strain 20-20 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | QEN57_RS06415 | Protein ID | WP_000911330.1 |
Coordinates | 1320758..1321156 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | U9XQV3 |
Locus tag | QEN57_RS06410 | Protein ID | WP_000450524.1 |
Coordinates | 1320531..1320758 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QEN57_RS06385 (1316334) | 1316334..1316804 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
QEN57_RS06390 (1316804) | 1316804..1317376 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
QEN57_RS06395 (1317522) | 1317522..1318400 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
QEN57_RS06400 (1318417) | 1318417..1319451 | + | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
QEN57_RS06405 (1319664) | 1319664..1320377 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
QEN57_RS06410 (1320531) | 1320531..1320758 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
QEN57_RS06415 (1320758) | 1320758..1321156 | + | 399 | WP_000911330.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QEN57_RS06420 (1321303) | 1321303..1322166 | + | 864 | WP_001267507.1 | neutral zinc metallopeptidase | - |
QEN57_RS06425 (1322181) | 1322181..1324196 | + | 2016 | WP_000829323.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
QEN57_RS06430 (1324270) | 1324270..1324611 | + | 342 | Protein_1255 | esterase | - |
QEN57_RS06435 (1324693) | 1324693..1325439 | - | 747 | WP_053906593.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14894.25 Da Isoelectric Point: 9.2216
>T278492 WP_000911330.1 NZ_CP123029:1320758-1321156 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|