Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 79175..79700 | Replicon | plasmid p20-16P1 |
| Accession | NZ_CP123025 | ||
| Organism | Escherichia coli strain 20-16 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | V0SSI5 |
| Locus tag | QEN53_RS23925 | Protein ID | WP_001159868.1 |
| Coordinates | 79175..79480 (-) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | A0A223LLB0 |
| Locus tag | QEN53_RS23930 | Protein ID | WP_023909027.1 |
| Coordinates | 79482..79700 (-) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QEN53_RS23910 (75085) | 75085..76251 | - | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
| QEN53_RS23915 (76839) | 76839..77594 | - | 756 | WP_000852146.1 | replication initiation protein RepE | - |
| QEN53_RS23920 (78368) | 78368..79174 | - | 807 | WP_000016982.1 | site-specific integrase | - |
| QEN53_RS23925 (79175) | 79175..79480 | - | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| QEN53_RS23930 (79482) | 79482..79700 | - | 219 | WP_023909027.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| QEN53_RS23935 (80334) | 80334..80531 | + | 198 | WP_000215657.1 | hypothetical protein | - |
| QEN53_RS23940 (80528) | 80528..80812 | - | 285 | WP_000642771.1 | hypothetical protein | - |
| QEN53_RS23945 (80832) | 80832..81965 | - | 1134 | WP_000545983.1 | DUF3800 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | tet(B) / sul1 / qacE / aadA2 / dfrA12 / blaNDM-5 / aadA5 / mph(A) / aph(6)-Id / aph(3'')-Ib / sul2 / blaTEM-1B / blaCTX-M-15 / blaOXA-1 / aac(6')-Ib-cr | - | 1..100602 | 100602 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T278483 WP_001159868.1 NZ_CP123025:c79480-79175 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|