Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1869185..1870017 Replicon chromosome
Accession NZ_CP123024
Organism Escherichia coli strain 20-16

Toxin (Protein)


Gene name yeeV Uniprot ID A0A0Q2Y5N3
Locus tag QEN53_RS09000 Protein ID WP_001514886.1
Coordinates 1869185..1869559 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A7U9IW59
Locus tag QEN53_RS09005 Protein ID WP_001360327.1
Coordinates 1869649..1870017 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QEN53_RS08965 (1864701) 1864701..1865174 + 474 WP_001105385.1 DNA gyrase inhibitor SbmC -
QEN53_RS08970 (1865373) 1865373..1866431 + 1059 WP_032181141.1 FUSC family protein -
QEN53_RS08975 (1866603) 1866603..1866932 + 330 WP_000450409.1 DUF496 family protein -
QEN53_RS08980 (1867033) 1867033..1867299 - 267 WP_063121129.1 EutP/PduV family microcompartment system protein -
QEN53_RS08985 (1867669) 1867669..1868040 - 372 WP_001295631.1 IS110 family transposase -
QEN53_RS08990 (1868856) 1868856..1868936 - 81 Protein_1759 hypothetical protein -
QEN53_RS08995 (1869036) 1869036..1869188 - 153 Protein_1760 DUF5983 family protein -
QEN53_RS09000 (1869185) 1869185..1869559 - 375 WP_001514886.1 TA system toxin CbtA family protein Toxin
QEN53_RS09005 (1869649) 1869649..1870017 - 369 WP_001360327.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QEN53_RS09010 (1870180) 1870180..1870401 - 222 WP_000692345.1 DUF987 domain-containing protein -
QEN53_RS09015 (1870464) 1870464..1870940 - 477 WP_001186747.1 RadC family protein -
QEN53_RS09020 (1870956) 1870956..1871429 - 474 WP_000855059.1 antirestriction protein -
QEN53_RS09025 (1871771) 1871771..1872589 - 819 WP_088540043.1 DUF932 domain-containing protein -
QEN53_RS09030 (1872707) 1872707..1872878 - 172 Protein_1767 DUF905 family protein -
QEN53_RS09035 (1873059) 1873059..1874600 + 1542 WP_001298859.1 IS21-like element ISEc12 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1844948..1878406 33458


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13930.91 Da        Isoelectric Point: 7.2909

>T278469 WP_001514886.1 NZ_CP123024:c1869559-1869185 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQSGF
SAGASSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13593.34 Da        Isoelectric Point: 5.9598

>AT278469 WP_001360327.1 NZ_CP123024:c1870017-1869649 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0Q2Y5N3

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9IW59

References