Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 68952..69595 | Replicon | plasmid p19-7P2 |
Accession | NZ_CP123019 | ||
Organism | Escherichia coli strain 19-7 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | B1LRW4 |
Locus tag | QEN55_RS24315 | Protein ID | WP_001044768.1 |
Coordinates | 69179..69595 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | D2WFK3 |
Locus tag | QEN55_RS24310 | Protein ID | WP_001261287.1 |
Coordinates | 68952..69182 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QEN55_RS24300 (64130) | 64130..65263 | - | 1134 | WP_000545983.1 | DUF3800 domain-containing protein | - |
QEN55_RS24305 (65526) | 65526..68645 | - | 3120 | WP_023909028.1 | hypothetical protein | - |
QEN55_RS24310 (68952) | 68952..69182 | + | 231 | WP_001261287.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
QEN55_RS24315 (69179) | 69179..69595 | + | 417 | WP_001044768.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QEN55_RS24320 (69757) | 69757..71895 | - | 2139 | WP_000350635.1 | AAA family ATPase | - |
QEN55_RS24325 (72360) | 72360..73355 | + | 996 | WP_000246636.1 | hypothetical protein | - |
QEN55_RS24330 (73398) | 73398..74291 | + | 894 | WP_001553853.1 | S-4TM family putative pore-forming effector | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | tet(B) / sul1 / qacE / aadA2 / dfrA12 / blaNDM-5 / aadA5 / blaTEM-1B / blaCTX-M-15 / blaOXA-1 / aac(6')-Ib-cr | - | 1..83900 | 83900 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15197.66 Da Isoelectric Point: 7.7805
>T278458 WP_001044768.1 NZ_CP123019:69179-69595 [Escherichia coli]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A606Q844 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QFC4 |