Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 62473..62998 | Replicon | plasmid p19-7P2 |
Accession | NZ_CP123019 | ||
Organism | Escherichia coli strain 19-7 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | V0SSI5 |
Locus tag | QEN55_RS24280 | Protein ID | WP_001159868.1 |
Coordinates | 62473..62778 (-) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | A0A223LLB0 |
Locus tag | QEN55_RS24285 | Protein ID | WP_023909027.1 |
Coordinates | 62780..62998 (-) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QEN55_RS24265 (58383) | 58383..59549 | - | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
QEN55_RS24270 (60137) | 60137..60892 | - | 756 | WP_000852146.1 | replication initiation protein RepE | - |
QEN55_RS24275 (61666) | 61666..62472 | - | 807 | WP_000016982.1 | site-specific integrase | - |
QEN55_RS24280 (62473) | 62473..62778 | - | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
QEN55_RS24285 (62780) | 62780..62998 | - | 219 | WP_023909027.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
QEN55_RS24290 (63632) | 63632..63829 | + | 198 | WP_000215657.1 | hypothetical protein | - |
QEN55_RS24295 (63826) | 63826..64110 | - | 285 | WP_000642771.1 | hypothetical protein | - |
QEN55_RS24300 (64130) | 64130..65263 | - | 1134 | WP_000545983.1 | DUF3800 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | tet(B) / sul1 / qacE / aadA2 / dfrA12 / blaNDM-5 / aadA5 / blaTEM-1B / blaCTX-M-15 / blaOXA-1 / aac(6')-Ib-cr | - | 1..83900 | 83900 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T278457 WP_001159868.1 NZ_CP123019:c62778-62473 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|