Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3604771..3605389 | Replicon | chromosome |
Accession | NZ_CP123017 | ||
Organism | Escherichia coli strain 19-7 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | QEN55_RS17530 | Protein ID | WP_001291435.1 |
Coordinates | 3605171..3605389 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | QEN55_RS17525 | Protein ID | WP_000344800.1 |
Coordinates | 3604771..3605145 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QEN55_RS17515 (3599860) | 3599860..3601053 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
QEN55_RS17520 (3601076) | 3601076..3604225 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
QEN55_RS17525 (3604771) | 3604771..3605145 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
QEN55_RS17530 (3605171) | 3605171..3605389 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
QEN55_RS17535 (3605561) | 3605561..3606112 | + | 552 | WP_000102568.1 | maltose O-acetyltransferase | - |
QEN55_RS17540 (3606228) | 3606228..3606698 | + | 471 | WP_000136192.1 | YlaC family protein | - |
QEN55_RS17545 (3606862) | 3606862..3608412 | + | 1551 | WP_001372022.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
QEN55_RS17550 (3608454) | 3608454..3608807 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
QEN55_RS17560 (3609186) | 3609186..3609497 | + | 312 | WP_000409911.1 | MGMT family protein | - |
QEN55_RS17565 (3609528) | 3609528..3610100 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T278451 WP_001291435.1 NZ_CP123017:3605171-3605389 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT278451 WP_000344800.1 NZ_CP123017:3604771-3605145 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |