Detailed information of TA system TA278449

Bioinformatically predicted

Overview

TA module

• Type: IV
• Classification (family/domain): yeeUV (cbtA-cbeA)/CbtA-CbeA
• Location: 2897696..2898540
• Replicon: chromosome
• Accession: NZ_CP123017
• Organism: Escherichia coli strain 19-7

Toxin (Protein)

• Gene name: yeeV
• Uniprot ID: B1LJY4
• Locus tag: QEN55_RS14135
• Protein ID: WP_000854686.1
• Coordinates: 2897696..2898079 (-)
• Length: 128 a.a.

Antitoxin (Protein)

• Gene name: yeeU
• Uniprot ID: A0A8E0J1S3
• Locus tag: QEN55_RS14140
• Protein ID: WP_001285602.1
• Coordinates: 2898160..2898540 (-)
• Length: 127 a.a.

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
QEN55_RS14095 (2892699)	2892699..2893190	-	492	WP_001297187.1	DUF1097 domain-containing protein	-
QEN55_RS14100 (2893292)	2893292..2893846	-	555	WP_001001902.1	molecular chaperone YcdY	-
QEN55_RS14105 (2893870)	2893870..2894607	-	738	WP_000283664.1	zinc-binding phosphatase	-
QEN55_RS14110 (2894662)	2894662..2895600	-	939	WP_000351311.1	glyoxylate/hydroxypyruvate reductase GhrA	-
QEN55_RS14120 (2896071)	2896071..2896912	-	842	Protein_2769	DUF4942 domain-containing protein	-
QEN55_RS14125 (2896997)	2896997..2897194	-	198	WP_000839253.1	DUF957 domain-containing protein	-
QEN55_RS14130 (2897211)	2897211..2897699	-	489	WP_032180032.1	DUF5983 family protein	-
QEN55_RS14135 (2897696)	2897696..2898079	-	384	WP_000854686.1	TA system toxin CbtA family protein	Toxin
QEN55_RS14140 (2898160)	2898160..2898540	-	381	WP_001285602.1	type IV toxin-antitoxin system YeeU family antitoxin	Antitoxin
QEN55_RS14145 (2898551)	2898551..2899234	-	684	WP_000086768.1	hypothetical protein	-
QEN55_RS14150 (2899253)	2899253..2899474	-	222	WP_000692298.1	DUF987 domain-containing protein	-
QEN55_RS14155 (2899537)	2899537..2900013	-	477	WP_001186726.1	RadC family protein	-
QEN55_RS14160 (2900029)	2900029..2900514	-	486	WP_000214307.1	antirestriction protein	-
QEN55_RS14165 (2900606)	2900606..2901427	-	822	WP_001761104.1	DUF932 domain-containing protein	-
QEN55_RS14170 (2901528)	2901528..2901736	-	209	Protein_2779	DUF905 family protein	-
QEN55_RS14175 (2901837)	2901837..2902292	-	456	WP_000581506.1	IrmA family protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Genomic island	blaCMY-2	csgB / csgD / csgE / csgF / csgG	2889081..2945047	55966

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• CbtA toxin of type IV toxin-antitoxin system (1-113)

Antitoxin

• Antitoxin CbeA (18-117)

Sequences

Toxin

Protein

• Length: 128 a.a.
• Molecular weight: 14272.28 Da
• Isoelectric Point: 6.8614

>T278449 WP_000854686.1 NZ_CP123017:c2898079-2897696 [Escherichia coli]
MKTLPDTHVRAASRCPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYVLVRTDQPGF
SAGAPSSQLINSIDILRARRATGLMTRDNYRMVNNITLGKHPEEAKQ

Nucleotide

• Length: 384 bp

Antitoxin

Protein

• Length: 127 a.a.
• Molecular weight: 13938.69 Da
• Isoelectric Point: 5.0823

>AT278449 WP_001285602.1 NZ_CP123017:c2898540-2898160 [Escherichia coli]
VSDTLPGTTLPDDNKDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE

Nucleotide

• Length: 381 bp