Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 2897696..2898540 | Replicon | chromosome |
| Accession | NZ_CP123017 | ||
| Organism | Escherichia coli strain 19-7 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | B1LJY4 |
| Locus tag | QEN55_RS14135 | Protein ID | WP_000854686.1 |
| Coordinates | 2897696..2898079 (-) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A8E0J1S3 |
| Locus tag | QEN55_RS14140 | Protein ID | WP_001285602.1 |
| Coordinates | 2898160..2898540 (-) | Length | 127 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QEN55_RS14095 (2892699) | 2892699..2893190 | - | 492 | WP_001297187.1 | DUF1097 domain-containing protein | - |
| QEN55_RS14100 (2893292) | 2893292..2893846 | - | 555 | WP_001001902.1 | molecular chaperone YcdY | - |
| QEN55_RS14105 (2893870) | 2893870..2894607 | - | 738 | WP_000283664.1 | zinc-binding phosphatase | - |
| QEN55_RS14110 (2894662) | 2894662..2895600 | - | 939 | WP_000351311.1 | glyoxylate/hydroxypyruvate reductase GhrA | - |
| QEN55_RS14120 (2896071) | 2896071..2896912 | - | 842 | Protein_2769 | DUF4942 domain-containing protein | - |
| QEN55_RS14125 (2896997) | 2896997..2897194 | - | 198 | WP_000839253.1 | DUF957 domain-containing protein | - |
| QEN55_RS14130 (2897211) | 2897211..2897699 | - | 489 | WP_032180032.1 | DUF5983 family protein | - |
| QEN55_RS14135 (2897696) | 2897696..2898079 | - | 384 | WP_000854686.1 | TA system toxin CbtA family protein | Toxin |
| QEN55_RS14140 (2898160) | 2898160..2898540 | - | 381 | WP_001285602.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QEN55_RS14145 (2898551) | 2898551..2899234 | - | 684 | WP_000086768.1 | hypothetical protein | - |
| QEN55_RS14150 (2899253) | 2899253..2899474 | - | 222 | WP_000692298.1 | DUF987 domain-containing protein | - |
| QEN55_RS14155 (2899537) | 2899537..2900013 | - | 477 | WP_001186726.1 | RadC family protein | - |
| QEN55_RS14160 (2900029) | 2900029..2900514 | - | 486 | WP_000214307.1 | antirestriction protein | - |
| QEN55_RS14165 (2900606) | 2900606..2901427 | - | 822 | WP_001761104.1 | DUF932 domain-containing protein | - |
| QEN55_RS14170 (2901528) | 2901528..2901736 | - | 209 | Protein_2779 | DUF905 family protein | - |
| QEN55_RS14175 (2901837) | 2901837..2902292 | - | 456 | WP_000581506.1 | IrmA family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | blaCMY-2 | csgB / csgD / csgE / csgF / csgG | 2889081..2945047 | 55966 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14272.28 Da Isoelectric Point: 6.8614
>T278449 WP_000854686.1 NZ_CP123017:c2898079-2897696 [Escherichia coli]
MKTLPDTHVRAASRCPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYVLVRTDQPGF
SAGAPSSQLINSIDILRARRATGLMTRDNYRMVNNITLGKHPEEAKQ
MKTLPDTHVRAASRCPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYVLVRTDQPGF
SAGAPSSQLINSIDILRARRATGLMTRDNYRMVNNITLGKHPEEAKQ
Download Length: 384 bp
Antitoxin
Download Length: 127 a.a. Molecular weight: 13938.69 Da Isoelectric Point: 5.0823
>AT278449 WP_001285602.1 NZ_CP123017:c2898540-2898160 [Escherichia coli]
VSDTLPGTTLPDDNKDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE
VSDTLPGTTLPDDNKDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE
Download Length: 381 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|