Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1349732..1350357 | Replicon | chromosome |
Accession | NZ_CP123017 | ||
Organism | Escherichia coli strain 19-7 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | QEN55_RS06595 | Protein ID | WP_000911330.1 |
Coordinates | 1349959..1350357 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | U9XQV3 |
Locus tag | QEN55_RS06590 | Protein ID | WP_000450524.1 |
Coordinates | 1349732..1349959 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QEN55_RS06565 (1345535) | 1345535..1346005 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
QEN55_RS06570 (1346005) | 1346005..1346577 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
QEN55_RS06575 (1346723) | 1346723..1347601 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
QEN55_RS06580 (1347618) | 1347618..1348652 | + | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
QEN55_RS06585 (1348865) | 1348865..1349578 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
QEN55_RS06590 (1349732) | 1349732..1349959 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
QEN55_RS06595 (1349959) | 1349959..1350357 | + | 399 | WP_000911330.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QEN55_RS06600 (1350504) | 1350504..1351367 | + | 864 | WP_001267507.1 | neutral zinc metallopeptidase | - |
QEN55_RS06605 (1351382) | 1351382..1353397 | + | 2016 | WP_000829323.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
QEN55_RS06610 (1353471) | 1353471..1353812 | + | 342 | Protein_1291 | esterase | - |
QEN55_RS06615 (1353894) | 1353894..1354640 | - | 747 | WP_053906593.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14894.25 Da Isoelectric Point: 9.2216
>T278441 WP_000911330.1 NZ_CP123017:1349959-1350357 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|