Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 49342..50143 Replicon chromosome
Accession NZ_CP123017
Organism Escherichia coli strain 19-7

Toxin (Protein)


Gene name yeeV Uniprot ID A0A0E0XS49
Locus tag QEN55_RS00255 Protein ID WP_001094437.1
Coordinates 49342..49719 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A0E0XTQ1
Locus tag QEN55_RS00260 Protein ID WP_001390338.1
Coordinates 49766..50143 (-) Length 126 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QEN55_RS00225 (44699) 44699..45622 - 924 WP_000535960.1 carboxylate/amino acid/amine transporter -
QEN55_RS00230 (45733) 45733..46917 - 1185 WP_001172877.1 sugar efflux transporter -
QEN55_RS00235 (47347) 47347..47475 - 129 Protein_46 RhuM family protein -
QEN55_RS00240 (47710) 47710..48555 - 846 WP_001274561.1 DUF4942 domain-containing protein -
QEN55_RS00245 (48640) 48640..48837 - 198 WP_000772032.1 DUF957 domain-containing protein -
QEN55_RS00250 (48857) 48857..49345 - 489 WP_000761716.1 DUF5983 family protein -
QEN55_RS00255 (49342) 49342..49719 - 378 WP_001094437.1 TA system toxin CbtA family protein Toxin
QEN55_RS00260 (49766) 49766..50143 - 378 WP_001390338.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QEN55_RS00265 (50306) 50306..50527 - 222 WP_000692345.1 DUF987 domain-containing protein -
QEN55_RS00270 (50590) 50590..51066 - 477 WP_001186747.1 RadC family protein -
QEN55_RS00275 (51082) 51082..51252 - 171 Protein_54 antirestriction protein -
QEN55_RS00280 (51254) 51254..51595 - 342 Protein_55 AIDA repeat-containing protein -
QEN55_RS00285 (51680) 51680..52426 - 747 WP_053906593.1 IS21-like element ISEc12 family helper ATPase IstB -
QEN55_RS00290 (52441) 52441..53982 - 1542 WP_001298859.1 IS21-like element ISEc12 family transposase -
QEN55_RS00295 (54161) 54161..54301 - 141 WP_280102390.1 hypothetical protein -
QEN55_RS00300 (54265) 54265..54606 - 342 Protein_59 ESPR-type extended signal peptide-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13986.90 Da        Isoelectric Point: 7.3223

>T278433 WP_001094437.1 NZ_CP123017:c49719-49342 [Escherichia coli]
MNTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR

Download         Length: 378 bp

Antitoxin


Download         Length: 126 a.a.        Molecular weight: 13745.44 Da        Isoelectric Point: 5.0463

>AT278433 WP_001390338.1 NZ_CP123017:c50143-49766 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTITLYAKGLTCEADTLGSCGYAYLAVYPTPAEPAITV

Download         Length: 378 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0XS49

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0XTQ1

References