Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 86431..86956 | Replicon | plasmid p18-4P1 |
Accession | NZ_CP123014 | ||
Organism | Escherichia coli strain 18-4 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | V0SSI5 |
Locus tag | QEN56_RS23990 | Protein ID | WP_001159868.1 |
Coordinates | 86431..86736 (-) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | A0A223LLB0 |
Locus tag | QEN56_RS23995 | Protein ID | WP_023909027.1 |
Coordinates | 86738..86956 (-) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QEN56_RS23975 (82341) | 82341..83507 | - | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
QEN56_RS23980 (84095) | 84095..84850 | - | 756 | WP_000852146.1 | replication initiation protein RepE | - |
QEN56_RS23985 (85624) | 85624..86430 | - | 807 | WP_000016982.1 | site-specific integrase | - |
QEN56_RS23990 (86431) | 86431..86736 | - | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
QEN56_RS23995 (86738) | 86738..86956 | - | 219 | WP_023909027.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
QEN56_RS24000 (87590) | 87590..87787 | + | 198 | WP_000215657.1 | hypothetical protein | - |
QEN56_RS24005 (87784) | 87784..88068 | - | 285 | WP_000642771.1 | hypothetical protein | - |
QEN56_RS24010 (88088) | 88088..89221 | - | 1134 | WP_000545983.1 | DUF3800 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | tet(B) / sul1 / qacE / aadA2 / dfrA12 / blaNDM-5 / blaTEM-1B / aac(3)-IId / mph(A) / aph(6)-Id / aph(3'')-Ib / sul2 / blaCTX-M-15 / blaOXA-1 / aac(6')-Ib-cr | - | 1..107858 | 107858 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T278431 WP_001159868.1 NZ_CP123014:c86736-86431 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|