Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 2893898..2894742 Replicon chromosome
Accession NZ_CP123013
Organism Escherichia coli strain 18-4

Toxin (Protein)


Gene name yeeV Uniprot ID B1LJY4
Locus tag QEN56_RS14120 Protein ID WP_000854686.1
Coordinates 2893898..2894281 (-) Length 128 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A8E0J1S3
Locus tag QEN56_RS14125 Protein ID WP_001285602.1
Coordinates 2894362..2894742 (-) Length 127 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QEN56_RS14080 (2888901) 2888901..2889392 - 492 WP_001297187.1 DUF1097 domain-containing protein -
QEN56_RS14085 (2889494) 2889494..2890048 - 555 WP_001001902.1 molecular chaperone YcdY -
QEN56_RS14090 (2890072) 2890072..2890809 - 738 WP_000283664.1 zinc-binding phosphatase -
QEN56_RS14095 (2890864) 2890864..2891802 - 939 WP_000351311.1 glyoxylate/hydroxypyruvate reductase GhrA -
QEN56_RS14105 (2892273) 2892273..2893114 - 842 Protein_2765 DUF4942 domain-containing protein -
QEN56_RS14110 (2893199) 2893199..2893396 - 198 WP_000839253.1 DUF957 domain-containing protein -
QEN56_RS14115 (2893413) 2893413..2893901 - 489 WP_032180032.1 DUF5983 family protein -
QEN56_RS14120 (2893898) 2893898..2894281 - 384 WP_000854686.1 TA system toxin CbtA family protein Toxin
QEN56_RS14125 (2894362) 2894362..2894742 - 381 WP_001285602.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QEN56_RS14130 (2894753) 2894753..2895436 - 684 WP_000086768.1 hypothetical protein -
QEN56_RS14135 (2895455) 2895455..2895676 - 222 WP_000692298.1 DUF987 domain-containing protein -
QEN56_RS14140 (2895739) 2895739..2896215 - 477 WP_001186726.1 RadC family protein -
QEN56_RS14145 (2896231) 2896231..2896716 - 486 WP_000214307.1 antirestriction protein -
QEN56_RS14150 (2896808) 2896808..2897629 - 822 WP_001761104.1 DUF932 domain-containing protein -
QEN56_RS14155 (2897730) 2897730..2897938 - 209 Protein_2775 DUF905 family protein -
QEN56_RS14160 (2898039) 2898039..2898494 - 456 WP_000581506.1 IrmA family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island blaCMY-2 csgB / csgD / csgE / csgF / csgG 2885283..2941249 55966


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-113)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 128 a.a.        Molecular weight: 14272.28 Da        Isoelectric Point: 6.8614

>T278423 WP_000854686.1 NZ_CP123013:c2894281-2893898 [Escherichia coli]
MKTLPDTHVRAASRCPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYVLVRTDQPGF
SAGAPSSQLINSIDILRARRATGLMTRDNYRMVNNITLGKHPEEAKQ

Download         Length: 384 bp

Antitoxin


Download         Length: 127 a.a.        Molecular weight: 13938.69 Da        Isoelectric Point: 5.0823

>AT278423 WP_001285602.1 NZ_CP123013:c2894742-2894362 [Escherichia coli]
VSDTLPGTTLPDDNKDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE

Download         Length: 381 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References