Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 2893898..2894742 | Replicon | chromosome |
| Accession | NZ_CP123013 | ||
| Organism | Escherichia coli strain 18-4 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | B1LJY4 |
| Locus tag | QEN56_RS14120 | Protein ID | WP_000854686.1 |
| Coordinates | 2893898..2894281 (-) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A8E0J1S3 |
| Locus tag | QEN56_RS14125 | Protein ID | WP_001285602.1 |
| Coordinates | 2894362..2894742 (-) | Length | 127 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QEN56_RS14080 (2888901) | 2888901..2889392 | - | 492 | WP_001297187.1 | DUF1097 domain-containing protein | - |
| QEN56_RS14085 (2889494) | 2889494..2890048 | - | 555 | WP_001001902.1 | molecular chaperone YcdY | - |
| QEN56_RS14090 (2890072) | 2890072..2890809 | - | 738 | WP_000283664.1 | zinc-binding phosphatase | - |
| QEN56_RS14095 (2890864) | 2890864..2891802 | - | 939 | WP_000351311.1 | glyoxylate/hydroxypyruvate reductase GhrA | - |
| QEN56_RS14105 (2892273) | 2892273..2893114 | - | 842 | Protein_2765 | DUF4942 domain-containing protein | - |
| QEN56_RS14110 (2893199) | 2893199..2893396 | - | 198 | WP_000839253.1 | DUF957 domain-containing protein | - |
| QEN56_RS14115 (2893413) | 2893413..2893901 | - | 489 | WP_032180032.1 | DUF5983 family protein | - |
| QEN56_RS14120 (2893898) | 2893898..2894281 | - | 384 | WP_000854686.1 | TA system toxin CbtA family protein | Toxin |
| QEN56_RS14125 (2894362) | 2894362..2894742 | - | 381 | WP_001285602.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QEN56_RS14130 (2894753) | 2894753..2895436 | - | 684 | WP_000086768.1 | hypothetical protein | - |
| QEN56_RS14135 (2895455) | 2895455..2895676 | - | 222 | WP_000692298.1 | DUF987 domain-containing protein | - |
| QEN56_RS14140 (2895739) | 2895739..2896215 | - | 477 | WP_001186726.1 | RadC family protein | - |
| QEN56_RS14145 (2896231) | 2896231..2896716 | - | 486 | WP_000214307.1 | antirestriction protein | - |
| QEN56_RS14150 (2896808) | 2896808..2897629 | - | 822 | WP_001761104.1 | DUF932 domain-containing protein | - |
| QEN56_RS14155 (2897730) | 2897730..2897938 | - | 209 | Protein_2775 | DUF905 family protein | - |
| QEN56_RS14160 (2898039) | 2898039..2898494 | - | 456 | WP_000581506.1 | IrmA family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | blaCMY-2 | csgB / csgD / csgE / csgF / csgG | 2885283..2941249 | 55966 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14272.28 Da Isoelectric Point: 6.8614
>T278423 WP_000854686.1 NZ_CP123013:c2894281-2893898 [Escherichia coli]
MKTLPDTHVRAASRCPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYVLVRTDQPGF
SAGAPSSQLINSIDILRARRATGLMTRDNYRMVNNITLGKHPEEAKQ
MKTLPDTHVRAASRCPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYVLVRTDQPGF
SAGAPSSQLINSIDILRARRATGLMTRDNYRMVNNITLGKHPEEAKQ
Download Length: 384 bp
Antitoxin
Download Length: 127 a.a. Molecular weight: 13938.69 Da Isoelectric Point: 5.0823
>AT278423 WP_001285602.1 NZ_CP123013:c2894742-2894362 [Escherichia coli]
VSDTLPGTTLPDDNKDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE
VSDTLPGTTLPDDNKDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE
Download Length: 381 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|