Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1872489..1873321 Replicon chromosome
Accession NZ_CP123013
Organism Escherichia coli strain 18-4

Toxin (Protein)


Gene name yeeV Uniprot ID A0A0Q2Y5N3
Locus tag QEN56_RS09010 Protein ID WP_001514886.1
Coordinates 1872489..1872863 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A7U9IW59
Locus tag QEN56_RS09015 Protein ID WP_001360327.1
Coordinates 1872953..1873321 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QEN56_RS08975 (1868005) 1868005..1868478 + 474 WP_001105385.1 DNA gyrase inhibitor SbmC -
QEN56_RS08980 (1868677) 1868677..1869735 + 1059 WP_032181141.1 FUSC family protein -
QEN56_RS08985 (1869907) 1869907..1870236 + 330 WP_000450409.1 DUF496 family protein -
QEN56_RS08990 (1870337) 1870337..1870603 - 267 WP_063121129.1 EutP/PduV family microcompartment system protein -
QEN56_RS08995 (1870973) 1870973..1871344 - 372 WP_001295631.1 IS110 family transposase -
QEN56_RS09000 (1872160) 1872160..1872240 - 81 Protein_1761 hypothetical protein -
QEN56_RS09005 (1872340) 1872340..1872492 - 153 Protein_1762 DUF5983 family protein -
QEN56_RS09010 (1872489) 1872489..1872863 - 375 WP_001514886.1 TA system toxin CbtA family protein Toxin
QEN56_RS09015 (1872953) 1872953..1873321 - 369 WP_001360327.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QEN56_RS09020 (1873484) 1873484..1873705 - 222 WP_000692345.1 DUF987 domain-containing protein -
QEN56_RS09025 (1873768) 1873768..1874244 - 477 WP_001186747.1 RadC family protein -
QEN56_RS09030 (1874260) 1874260..1874733 - 474 WP_000855059.1 antirestriction protein -
QEN56_RS09035 (1875075) 1875075..1875287 - 213 Protein_1768 DUF932 domain-containing protein -
QEN56_RS09040 (1875481) 1875481..1877022 + 1542 WP_001298859.1 IS21-like element ISEc12 family transposase -
QEN56_RS09045 (1877037) 1877037..1877783 + 747 WP_053906593.1 IS21-like element ISEc12 family helper ATPase IstB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13930.91 Da        Isoelectric Point: 7.2909

>T278417 WP_001514886.1 NZ_CP123013:c1872863-1872489 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQSGF
SAGASSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13593.34 Da        Isoelectric Point: 5.9598

>AT278417 WP_001360327.1 NZ_CP123013:c1873321-1872953 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0Q2Y5N3

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9IW59

References