Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 4101325..4101850 | Replicon | chromosome |
Accession | NZ_CP123009 | ||
Organism | Escherichia coli O155 strain NWU_3 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | - |
Locus tag | QEN28_RS19615 | Protein ID | WP_029305600.1 |
Coordinates | 4101545..4101850 (+) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | S1PPD8 |
Locus tag | QEN28_RS19610 | Protein ID | WP_000813634.1 |
Coordinates | 4101325..4101543 (+) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QEN28_RS19595 (4096481) | 4096481..4097380 | + | 900 | WP_000963206.1 | nucleotide-binding protein | - |
QEN28_RS19600 (4097430) | 4097430..4099655 | - | 2226 | WP_040073691.1 | P-loop NTPase fold protein | - |
QEN28_RS19605 (4099657) | 4099657..4100745 | - | 1089 | WP_000952217.1 | transcriptional repressor PifC | - |
QEN28_RS19610 (4101325) | 4101325..4101543 | + | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
QEN28_RS19615 (4101545) | 4101545..4101850 | + | 306 | WP_029305600.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
QEN28_RS19620 (4101851) | 4101851..4102432 | + | 582 | Protein_3859 | tyrosine-type recombinase/integrase | - |
QEN28_RS19625 (4102408) | 4102408..4102548 | + | 141 | Protein_3860 | RepB family plasmid replication initiator protein | - |
QEN28_RS19630 (4103136) | 4103136..4104302 | + | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
QEN28_RS19635 (4104302) | 4104302..4105273 | + | 972 | WP_000817031.1 | ParB/RepB/Spo0J family plasmid partition protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 4090602..4136494 | 45892 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11716.55 Da Isoelectric Point: 6.4674
>T278401 WP_029305600.1 NZ_CP123009:4101545-4101850 [Escherichia coli O155]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVPVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVPVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|