Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
| Location | 2255521..2256321 | Replicon | chromosome |
| Accession | NZ_CP123009 | ||
| Organism | Escherichia coli O155 strain NWU_3 | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | - |
| Locus tag | QEN28_RS11010 | Protein ID | WP_136721175.1 |
| Coordinates | 2255794..2256321 (+) | Length | 176 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | F4NNI1 |
| Locus tag | QEN28_RS11005 | Protein ID | WP_001277108.1 |
| Coordinates | 2255521..2255787 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QEN28_RS10985 (2251179) | 2251179..2251847 | + | 669 | WP_000617723.1 | cell division ATP-binding protein FtsE | - |
| QEN28_RS10990 (2251840) | 2251840..2252898 | + | 1059 | WP_001042003.1 | permease-like cell division protein FtsX | - |
| QEN28_RS10995 (2253143) | 2253143..2253997 | + | 855 | WP_000130217.1 | RNA polymerase sigma factor RpoH | - |
| QEN28_RS11000 (2254268) | 2254268..2255371 | + | 1104 | WP_001021996.1 | branched chain amino acid ABC transporter substrate-binding protein LivJ | - |
| QEN28_RS11005 (2255521) | 2255521..2255787 | + | 267 | WP_001277108.1 | type II toxin-antitoxin system antitoxin AtaR | Antitoxin |
| QEN28_RS11010 (2255794) | 2255794..2256321 | + | 528 | WP_136721175.1 | type II toxin-antitoxin system toxin acetyltransferase AtaT | Toxin |
| QEN28_RS11015 (2256318) | 2256318..2256701 | - | 384 | WP_000778795.1 | aspartate 1-decarboxylase autocleavage activator PanM | - |
| QEN28_RS11020 (2257125) | 2257125..2258234 | + | 1110 | WP_000827696.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
| QEN28_RS11025 (2258282) | 2258282..2259208 | + | 927 | WP_001295111.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| QEN28_RS11030 (2259205) | 2259205..2260482 | + | 1278 | WP_000803771.1 | branched chain amino acid ABC transporter permease LivM | - |
| QEN28_RS11035 (2260479) | 2260479..2261246 | + | 768 | WP_000082101.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19740.77 Da Isoelectric Point: 7.7438
>T278396 WP_136721175.1 NZ_CP123009:2255794-2256321 [Escherichia coli O155]
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLCGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNKKAHTFYQSLGFIPLVGENEYAL
FFPTKSIELLFTQSD
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLCGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNKKAHTFYQSLGFIPLVGENEYAL
FFPTKSIELLFTQSD
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|