Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1568741..1569359 | Replicon | chromosome |
Accession | NZ_CP123009 | ||
Organism | Escherichia coli O155 strain NWU_3 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | QEN28_RS07785 | Protein ID | WP_001291435.1 |
Coordinates | 1569141..1569359 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | QEN28_RS07780 | Protein ID | WP_000344800.1 |
Coordinates | 1568741..1569115 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QEN28_RS07770 (1563830) | 1563830..1565023 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
QEN28_RS07775 (1565046) | 1565046..1568195 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
QEN28_RS07780 (1568741) | 1568741..1569115 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
QEN28_RS07785 (1569141) | 1569141..1569359 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
QEN28_RS07790 (1569531) | 1569531..1570082 | + | 552 | WP_000102568.1 | maltose O-acetyltransferase | - |
QEN28_RS07795 (1570198) | 1570198..1570668 | + | 471 | WP_000136192.1 | YlaC family protein | - |
QEN28_RS07800 (1570832) | 1570832..1572382 | + | 1551 | WP_001299455.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
QEN28_RS07805 (1572424) | 1572424..1572777 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
QEN28_RS07815 (1573156) | 1573156..1573467 | + | 312 | WP_000409911.1 | MGMT family protein | - |
QEN28_RS07820 (1573498) | 1573498..1574070 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T278391 WP_001291435.1 NZ_CP123009:1569141-1569359 [Escherichia coli O155]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT278391 WP_000344800.1 NZ_CP123009:1568741-1569115 [Escherichia coli O155]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |