Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 1096237..1096875 | Replicon | chromosome |
Accession | NZ_CP123009 | ||
Organism | Escherichia coli O155 strain NWU_3 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | QEN28_RS05385 | Protein ID | WP_000813794.1 |
Coordinates | 1096699..1096875 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | QEN28_RS05380 | Protein ID | WP_136721302.1 |
Coordinates | 1096237..1096653 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QEN28_RS05360 (1091389) | 1091389..1092330 | - | 942 | WP_001251319.1 | ABC transporter permease | - |
QEN28_RS05365 (1092331) | 1092331..1093344 | - | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
QEN28_RS05370 (1093362) | 1093362..1094507 | - | 1146 | WP_000047456.1 | ABC transporter substrate-binding protein | - |
QEN28_RS05375 (1094752) | 1094752..1096158 | - | 1407 | WP_000760629.1 | PLP-dependent aminotransferase family protein | - |
QEN28_RS05380 (1096237) | 1096237..1096653 | - | 417 | WP_136721302.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
QEN28_RS05385 (1096699) | 1096699..1096875 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
QEN28_RS05390 (1097097) | 1097097..1097327 | + | 231 | WP_000494244.1 | YncJ family protein | - |
QEN28_RS05395 (1097419) | 1097419..1099380 | - | 1962 | WP_001307191.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
QEN28_RS05400 (1099453) | 1099453..1099989 | - | 537 | WP_000429141.1 | DNA-binding transcriptional regulator SutR | - |
QEN28_RS05405 (1100081) | 1100081..1101256 | + | 1176 | WP_001236319.1 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 1101296..1102561 | 1265 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T278389 WP_000813794.1 NZ_CP123009:c1096875-1096699 [Escherichia coli O155]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15245.69 Da Isoelectric Point: 5.1738
>AT278389 WP_136721302.1 NZ_CP123009:c1096653-1096237 [Escherichia coli O155]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAKAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAKAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|