Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 947819..948444 | Replicon | chromosome |
Accession | NZ_CP123009 | ||
Organism | Escherichia coli O155 strain NWU_3 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | QEN28_RS04685 | Protein ID | WP_000911330.1 |
Coordinates | 947819..948217 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | U9XQV3 |
Locus tag | QEN28_RS04690 | Protein ID | WP_000450524.1 |
Coordinates | 948217..948444 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QEN28_RS04665 (943697) | 943697..943897 | + | 201 | WP_000383836.1 | YpfN family protein | - |
QEN28_RS04670 (944007) | 944007..944705 | - | 699 | WP_000679823.1 | esterase | - |
QEN28_RS04675 (944779) | 944779..946794 | - | 2016 | WP_000829329.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
QEN28_RS04680 (946809) | 946809..947672 | - | 864 | WP_001267508.1 | neutral zinc metallopeptidase | - |
QEN28_RS04685 (947819) | 947819..948217 | - | 399 | WP_000911330.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QEN28_RS04690 (948217) | 948217..948444 | - | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
QEN28_RS04695 (948598) | 948598..949311 | - | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
QEN28_RS04700 (949524) | 949524..950558 | - | 1035 | WP_136721100.1 | outer membrane protein assembly factor BamC | - |
QEN28_RS04705 (950575) | 950575..951453 | - | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
QEN28_RS04710 (951599) | 951599..952171 | + | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
QEN28_RS04715 (952171) | 952171..952641 | + | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14894.25 Da Isoelectric Point: 9.2216
>T278388 WP_000911330.1 NZ_CP123009:c948217-947819 [Escherichia coli O155]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|