Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 3855858..3856483 | Replicon | chromosome |
| Accession | NZ_CP123008 | ||
| Organism | Escherichia coli strain NWU_4 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | QEN27_RS18590 | Protein ID | WP_000911317.1 |
| Coordinates | 3855858..3856256 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | L4J1D2 |
| Locus tag | QEN27_RS18595 | Protein ID | WP_000450532.1 |
| Coordinates | 3856256..3856483 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QEN27_RS18575 (3852184) | 3852184..3852681 | + | 498 | WP_000605859.1 | entry exclusion protein | - |
| QEN27_RS18580 (3852713) | 3852713..3853444 | + | 732 | WP_000850430.1 | conjugal transfer complement resistance protein TraT | - |
| QEN27_RS18585 (3853696) | 3853696..3855849 | + | 2154 | WP_023568632.1 | type IV conjugative transfer system coupling protein TraD | - |
| QEN27_RS18590 (3855858) | 3855858..3856256 | - | 399 | WP_000911317.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QEN27_RS18595 (3856256) | 3856256..3856483 | - | 228 | WP_000450532.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14857.14 Da Isoelectric Point: 8.5264
>T278377 WP_000911317.1 NZ_CP123008:c3856256-3855858 [Escherichia coli]
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVGGLRIEDWS
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVGGLRIEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|