Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 3812172..3812697 | Replicon | chromosome |
Accession | NZ_CP123008 | ||
Organism | Escherichia coli strain NWU_4 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | - |
Locus tag | QEN27_RS18295 | Protein ID | WP_029305600.1 |
Coordinates | 3812392..3812697 (+) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | S1PPD8 |
Locus tag | QEN27_RS18290 | Protein ID | WP_000813634.1 |
Coordinates | 3812172..3812390 (+) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QEN27_RS18275 (3807328) | 3807328..3808227 | + | 900 | WP_000963206.1 | nucleotide-binding protein | - |
QEN27_RS18280 (3808277) | 3808277..3810502 | - | 2226 | WP_040073691.1 | P-loop NTPase fold protein | - |
QEN27_RS18285 (3810504) | 3810504..3811592 | - | 1089 | WP_000952217.1 | transcriptional repressor PifC | - |
QEN27_RS18290 (3812172) | 3812172..3812390 | + | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
QEN27_RS18295 (3812392) | 3812392..3812697 | + | 306 | WP_029305600.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
QEN27_RS18300 (3812698) | 3812698..3813279 | + | 582 | Protein_3599 | tyrosine-type recombinase/integrase | - |
QEN27_RS18305 (3813255) | 3813255..3813395 | + | 141 | Protein_3600 | RepB family plasmid replication initiator protein | - |
QEN27_RS18310 (3813983) | 3813983..3815149 | + | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
QEN27_RS18315 (3815149) | 3815149..3816120 | + | 972 | WP_000817031.1 | ParB/RepB/Spo0J family plasmid partition protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 3786297..3816120 | 29823 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11716.55 Da Isoelectric Point: 6.4674
>T278373 WP_029305600.1 NZ_CP123008:3812392-3812697 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVPVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVPVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|