Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
| Location | 1928094..1928677 | Replicon | chromosome |
| Accession | NZ_CP123008 | ||
| Organism | Escherichia coli strain NWU_4 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | U9XFN8 |
| Locus tag | QEN27_RS09520 | Protein ID | WP_000254745.1 |
| Coordinates | 1928094..1928429 (-) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | S1P3W5 |
| Locus tag | QEN27_RS09525 | Protein ID | WP_000581937.1 |
| Coordinates | 1928429..1928677 (-) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QEN27_RS09500 (1923563) | 1923563..1923925 | + | 363 | WP_000034929.1 | hypothetical protein | - |
| QEN27_RS09505 (1923981) | 1923981..1925279 | - | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
| QEN27_RS09510 (1925367) | 1925367..1927004 | - | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
| QEN27_RS09515 (1927232) | 1927232..1928023 | - | 792 | WP_136721162.1 | nucleoside triphosphate pyrophosphohydrolase | - |
| QEN27_RS09520 (1928094) | 1928094..1928429 | - | 336 | WP_000254745.1 | endoribonuclease MazF | Toxin |
| QEN27_RS09525 (1928429) | 1928429..1928677 | - | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| QEN27_RS09530 (1928755) | 1928755..1930989 | - | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
| QEN27_RS09535 (1931037) | 1931037..1932338 | - | 1302 | WP_000046790.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12158.08 Da Isoelectric Point: 8.4777
>T278367 WP_000254745.1 NZ_CP123008:c1928429-1928094 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPYTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPYTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XYM3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 1UB4 | |
| PDB | 5CQX | |
| PDB | 5CQY | |
| PDB | 1MVF | |
| PDB | 2MRN | |
| PDB | 2MRU | |
| AlphaFold DB | A0A7U9LMB4 |