Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 1602769..1603606 | Replicon | chromosome |
Accession | NZ_CP123008 | ||
Organism | Escherichia coli strain NWU_4 |
Toxin (Protein)
Gene name | itaT | Uniprot ID | Q3Z4X7 |
Locus tag | QEN27_RS07965 | Protein ID | WP_000227784.1 |
Coordinates | 1603064..1603606 (+) | Length | 181 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | I2UQS9 |
Locus tag | QEN27_RS07960 | Protein ID | WP_001297137.1 |
Coordinates | 1602769..1603080 (+) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QEN27_RS07935 (1597789) | 1597789..1598736 | + | 948 | WP_001239441.1 | cytochrome o ubiquinol oxidase subunit II | - |
QEN27_RS07940 (1598758) | 1598758..1600749 | + | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
QEN27_RS07945 (1600739) | 1600739..1601353 | + | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
QEN27_RS07950 (1601353) | 1601353..1601682 | + | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
QEN27_RS07955 (1601694) | 1601694..1602584 | + | 891 | WP_000971336.1 | heme o synthase | - |
QEN27_RS07960 (1602769) | 1602769..1603080 | + | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
QEN27_RS07965 (1603064) | 1603064..1603606 | + | 543 | WP_000227784.1 | GNAT family N-acetyltransferase | Toxin |
QEN27_RS07970 (1603662) | 1603662..1604597 | - | 936 | WP_001297127.1 | tetratricopeptide repeat protein | - |
QEN27_RS07975 (1605005) | 1605005..1606369 | + | 1365 | WP_001000978.1 | MFS transporter | - |
QEN27_RS07980 (1606497) | 1606497..1606988 | - | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
QEN27_RS07985 (1607156) | 1607156..1608067 | + | 912 | WP_000705847.1 | 2-dehydropantoate 2-reductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19805.02 Da Isoelectric Point: 8.3395
>T278366 WP_000227784.1 NZ_CP123008:1603064-1603606 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|