Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 1568692..1569310 | Replicon | chromosome |
| Accession | NZ_CP123008 | ||
| Organism | Escherichia coli strain NWU_4 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | QEN27_RS07795 | Protein ID | WP_001291435.1 |
| Coordinates | 1569092..1569310 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | QEN27_RS07790 | Protein ID | WP_000344800.1 |
| Coordinates | 1568692..1569066 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QEN27_RS07780 (1563781) | 1563781..1564974 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| QEN27_RS07785 (1564997) | 1564997..1568146 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
| QEN27_RS07790 (1568692) | 1568692..1569066 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| QEN27_RS07795 (1569092) | 1569092..1569310 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| QEN27_RS07800 (1569482) | 1569482..1570033 | + | 552 | WP_000102568.1 | maltose O-acetyltransferase | - |
| QEN27_RS07805 (1570149) | 1570149..1570619 | + | 471 | WP_000136192.1 | YlaC family protein | - |
| QEN27_RS07810 (1570783) | 1570783..1572333 | + | 1551 | WP_001299455.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| QEN27_RS07815 (1572375) | 1572375..1572728 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
| QEN27_RS07825 (1573107) | 1573107..1573418 | + | 312 | WP_000409911.1 | MGMT family protein | - |
| QEN27_RS07830 (1573449) | 1573449..1574021 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T278365 WP_001291435.1 NZ_CP123008:1569092-1569310 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT278365 WP_000344800.1 NZ_CP123008:1568692-1569066 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |