Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 1467511..1468149 | Replicon | chromosome |
Accession | NZ_CP123008 | ||
Organism | Escherichia coli strain NWU_4 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | QEN27_RS07300 | Protein ID | WP_000813794.1 |
Coordinates | 1467511..1467687 (+) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | QEN27_RS07305 | Protein ID | WP_136721302.1 |
Coordinates | 1467733..1468149 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QEN27_RS07280 (1463130) | 1463130..1464305 | - | 1176 | WP_001236319.1 | BenE family transporter YdcO | - |
QEN27_RS07285 (1464397) | 1464397..1464933 | + | 537 | WP_000429141.1 | DNA-binding transcriptional regulator SutR | - |
QEN27_RS07290 (1465006) | 1465006..1466967 | + | 1962 | WP_001307191.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
QEN27_RS07295 (1467059) | 1467059..1467289 | - | 231 | WP_000494244.1 | YncJ family protein | - |
QEN27_RS07300 (1467511) | 1467511..1467687 | + | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
QEN27_RS07305 (1467733) | 1467733..1468149 | + | 417 | WP_136721302.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
QEN27_RS07310 (1468228) | 1468228..1469634 | + | 1407 | WP_000760629.1 | PLP-dependent aminotransferase family protein | - |
QEN27_RS07315 (1469879) | 1469879..1471024 | + | 1146 | WP_000047456.1 | ABC transporter substrate-binding protein | - |
QEN27_RS07320 (1471042) | 1471042..1472055 | + | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
QEN27_RS07325 (1472056) | 1472056..1472997 | + | 942 | WP_001251319.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 1461825..1463090 | 1265 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T278364 WP_000813794.1 NZ_CP123008:1467511-1467687 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15245.69 Da Isoelectric Point: 5.1738
>AT278364 WP_136721302.1 NZ_CP123008:1467733-1468149 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAKAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAKAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|