Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 947771..948396 | Replicon | chromosome |
Accession | NZ_CP123008 | ||
Organism | Escherichia coli strain NWU_4 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | QEN27_RS04690 | Protein ID | WP_000911330.1 |
Coordinates | 947771..948169 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | U9XQV3 |
Locus tag | QEN27_RS04695 | Protein ID | WP_000450524.1 |
Coordinates | 948169..948396 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QEN27_RS04670 (943649) | 943649..943849 | + | 201 | WP_000383836.1 | YpfN family protein | - |
QEN27_RS04675 (943959) | 943959..944657 | - | 699 | WP_000679823.1 | esterase | - |
QEN27_RS04680 (944731) | 944731..946746 | - | 2016 | WP_000829329.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
QEN27_RS04685 (946761) | 946761..947624 | - | 864 | WP_001267508.1 | neutral zinc metallopeptidase | - |
QEN27_RS04690 (947771) | 947771..948169 | - | 399 | WP_000911330.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QEN27_RS04695 (948169) | 948169..948396 | - | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
QEN27_RS04700 (948550) | 948550..949263 | - | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
QEN27_RS04705 (949476) | 949476..950510 | - | 1035 | WP_136721100.1 | outer membrane protein assembly factor BamC | - |
QEN27_RS04710 (950527) | 950527..951405 | - | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
QEN27_RS04715 (951551) | 951551..952123 | + | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
QEN27_RS04720 (952123) | 952123..952593 | + | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14894.25 Da Isoelectric Point: 9.2216
>T278355 WP_000911330.1 NZ_CP123008:c948169-947771 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|