Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
Location | 71223..71757 | Replicon | plasmid pSme442-SymB |
Accession | NZ_CP123006 | ||
Organism | Sinorhizobium meliloti strain BIM B-442D |
Toxin (Protein)
Gene name | parE | Uniprot ID | Q92X99 |
Locus tag | QC756_RS27600 | Protein ID | WP_010974986.1 |
Coordinates | 71461..71757 (+) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | H0FXK0 |
Locus tag | QC756_RS27595 | Protein ID | WP_003527850.1 |
Coordinates | 71223..71471 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QC756_RS27565 (QC756_27565) | 66675..67760 | + | 1086 | WP_014530873.1 | ABC transporter substrate-binding protein | - |
QC756_RS27570 (QC756_27570) | 67757..68800 | + | 1044 | WP_280097689.1 | iron ABC transporter permease | - |
QC756_RS27575 (QC756_27575) | 68797..69597 | + | 801 | WP_014530872.1 | ABC transporter ATP-binding protein | - |
QC756_RS27580 (QC756_27580) | 69601..70395 | + | 795 | WP_013850206.1 | methyltransferase domain-containing protein | - |
QC756_RS27585 (QC756_27585) | 70479..70604 | - | 126 | Protein_60 | IS481 family transposase | - |
QC756_RS27590 (QC756_27590) | 70960..71115 | + | 156 | WP_010974985.1 | hypothetical protein | - |
QC756_RS27595 (QC756_27595) | 71223..71471 | + | 249 | WP_003527850.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
QC756_RS27600 (QC756_27600) | 71461..71757 | + | 297 | WP_010974986.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QC756_RS27605 (QC756_27605) | 71838..72098 | - | 261 | Protein_64 | helix-turn-helix domain-containing protein | - |
QC756_RS27610 (QC756_27610) | 72679..73077 | + | 399 | WP_010974988.1 | hypothetical protein | - |
QC756_RS27615 (QC756_27615) | 73244..73429 | + | 186 | WP_010974989.1 | hypothetical protein | - |
QC756_RS27620 (QC756_27620) | 73433..73879 | - | 447 | WP_014527651.1 | DNA-binding protein | - |
QC756_RS27625 (QC756_27625) | 74169..74378 | + | 210 | WP_003527838.1 | dodecin family protein | - |
QC756_RS27630 (QC756_27630) | 74912..76315 | + | 1404 | WP_041862735.1 | sodium:alanine symporter family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | - | htpB | 1..1662188 | 1662188 | |
- | flank | IS/Tn | - | - | 70479..70670 | 191 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11473.15 Da Isoelectric Point: 10.6593
>T278347 WP_010974986.1 NZ_CP123006:71461-71757 [Sinorhizobium meliloti]
MATERPFRLAPTAKADLRKIWRYTARRWSLEQAETYQDQLYTAFEGLAVGTKKGRNVDVRPGYLKYPAGAHIVYFRDRGD
RIDIIRILHGRVDAQRHL
MATERPFRLAPTAKADLRKIWRYTARRWSLEQAETYQDQLYTAFEGLAVGTKKGRNVDVRPGYLKYPAGAHIVYFRDRGD
RIDIIRILHGRVDAQRHL
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|