Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RHH(antitoxin)
Location 71223..71757 Replicon plasmid pSme442-SymB
Accession NZ_CP123006
Organism Sinorhizobium meliloti strain BIM B-442D

Toxin (Protein)


Gene name parE Uniprot ID Q92X99
Locus tag QC756_RS27600 Protein ID WP_010974986.1
Coordinates 71461..71757 (+) Length 99 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID H0FXK0
Locus tag QC756_RS27595 Protein ID WP_003527850.1
Coordinates 71223..71471 (+) Length 83 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QC756_RS27565 (QC756_27565) 66675..67760 + 1086 WP_014530873.1 ABC transporter substrate-binding protein -
QC756_RS27570 (QC756_27570) 67757..68800 + 1044 WP_280097689.1 iron ABC transporter permease -
QC756_RS27575 (QC756_27575) 68797..69597 + 801 WP_014530872.1 ABC transporter ATP-binding protein -
QC756_RS27580 (QC756_27580) 69601..70395 + 795 WP_013850206.1 methyltransferase domain-containing protein -
QC756_RS27585 (QC756_27585) 70479..70604 - 126 Protein_60 IS481 family transposase -
QC756_RS27590 (QC756_27590) 70960..71115 + 156 WP_010974985.1 hypothetical protein -
QC756_RS27595 (QC756_27595) 71223..71471 + 249 WP_003527850.1 type II toxin-antitoxin system ParD family antitoxin Antitoxin
QC756_RS27600 (QC756_27600) 71461..71757 + 297 WP_010974986.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QC756_RS27605 (QC756_27605) 71838..72098 - 261 Protein_64 helix-turn-helix domain-containing protein -
QC756_RS27610 (QC756_27610) 72679..73077 + 399 WP_010974988.1 hypothetical protein -
QC756_RS27615 (QC756_27615) 73244..73429 + 186 WP_010974989.1 hypothetical protein -
QC756_RS27620 (QC756_27620) 73433..73879 - 447 WP_014527651.1 DNA-binding protein -
QC756_RS27625 (QC756_27625) 74169..74378 + 210 WP_003527838.1 dodecin family protein -
QC756_RS27630 (QC756_27630) 74912..76315 + 1404 WP_041862735.1 sodium:alanine symporter family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - htpB 1..1662188 1662188
- flank IS/Tn - - 70479..70670 191


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(8-91)

Antitoxin

Antitoxin ParD

(3-78)


Sequences

Toxin        


Download         Length: 99 a.a.        Molecular weight: 11473.15 Da        Isoelectric Point: 10.6593

>T278347 WP_010974986.1 NZ_CP123006:71461-71757 [Sinorhizobium meliloti]
MATERPFRLAPTAKADLRKIWRYTARRWSLEQAETYQDQLYTAFEGLAVGTKKGRNVDVRPGYLKYPAGAHIVYFRDRGD
RIDIIRILHGRVDAQRHL

Download         Length: 297 bp

Antitoxin


Download         Length: 83 a.a.        Molecular weight: 8888.73 Da        Isoelectric Point: 4.2176

>AT278347 WP_003527850.1 NZ_CP123006:71223-71471 [Sinorhizobium meliloti]
MAARSTSISLGDHFAGFIDSQVQTGRYGSASDVVRAGLRLLEEHEAKVRALEAALIEGEESGEPEPFDNEAFKAEMRAEY
GD

Download         Length: 249 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q92X99

Antitoxin

Source ID Structure
AlphaFold DB H0FXK0

References