Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VapB |
| Location | 1443511..1444091 | Replicon | plasmid pSme442-SymA |
| Accession | NZ_CP123005 | ||
| Organism | Sinorhizobium meliloti strain BIM B-442D | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | Q92XP1 |
| Locus tag | QC756_RS26595 | Protein ID | WP_010968151.1 |
| Coordinates | 1443708..1444091 (+) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | QC756_RS26590 | Protein ID | WP_088199999.1 |
| Coordinates | 1443511..1443711 (+) | Length | 67 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QC756_RS26565 (QC756_26565) | 1440480..1440644 | - | 165 | WP_234705952.1 | acyl-CoA dehydrogenase | - |
| QC756_RS26570 (QC756_26570) | 1440720..1441448 | - | 729 | WP_014531163.1 | class I SAM-dependent methyltransferase | - |
| QC756_RS26575 (QC756_26575) | 1441487..1441756 | - | 270 | WP_127725696.1 | DUF1127 domain-containing protein | - |
| QC756_RS26580 (QC756_26580) | 1441906..1442742 | + | 837 | WP_014531162.1 | helix-turn-helix transcriptional regulator | - |
| QC756_RS26585 (QC756_26585) | 1442819..1443220 | - | 402 | WP_014531161.1 | GFA family protein | - |
| QC756_RS26590 (QC756_26590) | 1443511..1443711 | + | 201 | WP_088199999.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| QC756_RS26595 (QC756_26595) | 1443708..1444091 | + | 384 | WP_010968151.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QC756_RS26600 (QC756_26600) | 1444363..1444665 | - | 303 | WP_003526036.1 | hypothetical protein | - |
| QC756_RS26605 (QC756_26605) | 1444685..1446919 | - | 2235 | WP_017268957.1 | prolyl oligopeptidase family serine peptidase | - |
| QC756_RS26610 (QC756_26610) | 1447916..1448851 | + | 936 | WP_014989617.1 | LysR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | htpB | 1..1592319 | 1592319 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14292.54 Da Isoelectric Point: 6.9172
>T278346 WP_010968151.1 NZ_CP123005:1443708-1444091 [Sinorhizobium meliloti]
VILADTSIWIDHFRHTDAELRRIIEDDRLLCHPAVIGELALGSLRERSSVIAFLMAQREALVATHQEVMMMIDRHAIFSM
GIGYTDAHLLASVLLDQRMALWTRDKRLQAAAEKAGASLHTPAHTRN
VILADTSIWIDHFRHTDAELRRIIEDDRLLCHPAVIGELALGSLRERSSVIAFLMAQREALVATHQEVMMMIDRHAIFSM
GIGYTDAHLLASVLLDQRMALWTRDKRLQAAAEKAGASLHTPAHTRN
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|