Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-RelB |
Location | 1400775..1401373 | Replicon | plasmid pSme442-SymA |
Accession | NZ_CP123005 | ||
Organism | Sinorhizobium meliloti strain BIM B-442D |
Toxin (Protein)
Gene name | relE | Uniprot ID | Q930F0 |
Locus tag | QC756_RS26330 | Protein ID | WP_010967243.1 |
Coordinates | 1400775..1401068 (-) | Length | 98 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | Q930F1 |
Locus tag | QC756_RS26335 | Protein ID | WP_010967242.1 |
Coordinates | 1401065..1401373 (-) | Length | 103 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QC756_RS26310 (QC756_26310) | 1396451..1397383 | - | 933 | WP_014531928.1 | VOC family protein | - |
QC756_RS26315 (QC756_26315) | 1397495..1398394 | + | 900 | WP_010967198.1 | LysR family transcriptional regulator | - |
QC756_RS26320 (QC756_26320) | 1398812..1399069 | - | 258 | WP_080567622.1 | hypothetical protein | - |
QC756_RS26325 (QC756_26325) | 1399343..1400542 | + | 1200 | WP_164828840.1 | NAD-dependent formate dehydrogenase | - |
QC756_RS26330 (QC756_26330) | 1400775..1401068 | - | 294 | WP_010967243.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | Toxin |
QC756_RS26335 (QC756_26335) | 1401065..1401373 | - | 309 | WP_010967242.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
QC756_RS26340 (QC756_26340) | 1401718..1401930 | + | 213 | WP_013845891.1 | hypothetical protein | - |
QC756_RS26345 (QC756_26345) | 1402082..1402309 | - | 228 | WP_234705589.1 | EAL domain-containing protein | - |
QC756_RS26350 (QC756_26350) | 1402446..1403336 | - | 891 | WP_017269181.1 | hypothetical protein | - |
QC756_RS26355 (QC756_26355) | 1403388..1405172 | - | 1785 | WP_095918731.1 | polysaccharide biosynthesis/export family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | htpB | 1..1592319 | 1592319 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11278.93 Da Isoelectric Point: 6.4734
>T278345 WP_010967243.1 NZ_CP123005:c1401068-1400775 [Sinorhizobium meliloti]
MRLVWARYALDDRDTIFSYIERENPRAAVHVDEEIVSAVRRLLDFPESGRPGRIAGTRELVIPRTPYIAAYMVMEDRIRI
LRVLHGAQKWPSELDDG
MRLVWARYALDDRDTIFSYIERENPRAAVHVDEEIVSAVRRLLDFPESGRPGRIAGTRELVIPRTPYIAAYMVMEDRIRI
LRVLHGAQKWPSELDDG
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|