278344

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE-RelB
Location 1362152..1362750 Replicon plasmid pSme442-SymA
Accession NZ_CP123005
Organism Sinorhizobium meliloti strain BIM B-442D

Toxin (Protein)


Gene name relE Uniprot ID Q930F0
Locus tag QC756_RS26130 Protein ID WP_010967243.1
Coordinates 1362152..1362445 (-) Length 98 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID Q930F1
Locus tag QC756_RS26135 Protein ID WP_010967242.1
Coordinates 1362442..1362750 (-) Length 103 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QC756_RS26110 (QC756_26110) 1358400..1359176 + 777 WP_014528764.1 histidinol-phosphatase -
QC756_RS26115 (QC756_26115) 1359554..1359811 - 258 WP_074853712.1 plasmid partitioning protein RepB C-terminal domain-containing protein -
QC756_RS26120 (QC756_26120) 1359745..1360305 - 561 WP_234708620.1 plasmid partitioning protein RepB C-terminal domain-containing protein -
QC756_RS26125 (QC756_26125) 1360720..1361919 + 1200 WP_164828840.1 NAD-dependent formate dehydrogenase -
QC756_RS26130 (QC756_26130) 1362152..1362445 - 294 WP_010967243.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family Toxin
QC756_RS26135 (QC756_26135) 1362442..1362750 - 309 WP_010967242.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
QC756_RS26140 (QC756_26140) 1362945..1363364 - 420 WP_268814887.1 plasmid partitioning protein RepB C-terminal domain-containing protein -
QC756_RS26145 (QC756_26145) 1363246..1363515 - 270 WP_201271733.1 plasmid partitioning protein RepB C-terminal domain-containing protein -
QC756_RS26150 (QC756_26150) 1363512..1363880 - 369 WP_028005933.1 ParB/RepB/Spo0J family partition protein -
QC756_RS26155 (QC756_26155) 1364019..1364219 + 201 Protein_1339 hypothetical protein -
QC756_RS26160 (QC756_26160) 1364250..1364609 + 360 WP_040120590.1 type II toxin-antitoxin system RelE/ParE family toxin -
QC756_RS26165 (QC756_26165) 1364599..1364922 + 324 WP_003526806.1 DNA-binding transcriptional regulator -
QC756_RS26170 (QC756_26170) 1365113..1366639 - 1527 WP_040120589.1 amidohydrolase -
QC756_RS26175 (QC756_26175) 1366636..1367574 - 939 WP_014532024.1 nucleoside hydrolase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - htpB 1..1592319 1592319


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-90)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(1-53)


Sequences

Toxin        


Download         Length: 98 a.a.        Molecular weight: 11278.93 Da        Isoelectric Point: 6.4734

>T278344 WP_010967243.1 NZ_CP123005:c1362445-1362152 [Sinorhizobium meliloti]
MRLVWARYALDDRDTIFSYIERENPRAAVHVDEEIVSAVRRLLDFPESGRPGRIAGTRELVIPRTPYIAAYMVMEDRIRI
LRVLHGAQKWPSELDDG

Download         Length: 294 bp

Antitoxin


Download         Length: 103 a.a.        Molecular weight: 11210.58 Da        Isoelectric Point: 5.6604

>AT278344 WP_010967242.1 NZ_CP123005:c1362750-1362442 [Sinorhizobium meliloti]
MASNALVQTRIDAEVKERATAVLENMGLTVSDAVRILLTRTANEGALPLELFSHSEAHDAWFRAKVLRALEDTRPDVDDA
DADAHFRERRAAALRKAAAGDR

Download         Length: 309 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q930F0

Antitoxin

Source ID Structure
AlphaFold DB Q930F1

References