Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE-RelB |
| Location | 1362152..1362750 | Replicon | plasmid pSme442-SymA |
| Accession | NZ_CP123005 | ||
| Organism | Sinorhizobium meliloti strain BIM B-442D | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | Q930F0 |
| Locus tag | QC756_RS26130 | Protein ID | WP_010967243.1 |
| Coordinates | 1362152..1362445 (-) | Length | 98 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | Q930F1 |
| Locus tag | QC756_RS26135 | Protein ID | WP_010967242.1 |
| Coordinates | 1362442..1362750 (-) | Length | 103 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QC756_RS26110 (QC756_26110) | 1358400..1359176 | + | 777 | WP_014528764.1 | histidinol-phosphatase | - |
| QC756_RS26115 (QC756_26115) | 1359554..1359811 | - | 258 | WP_074853712.1 | plasmid partitioning protein RepB C-terminal domain-containing protein | - |
| QC756_RS26120 (QC756_26120) | 1359745..1360305 | - | 561 | WP_234708620.1 | plasmid partitioning protein RepB C-terminal domain-containing protein | - |
| QC756_RS26125 (QC756_26125) | 1360720..1361919 | + | 1200 | WP_164828840.1 | NAD-dependent formate dehydrogenase | - |
| QC756_RS26130 (QC756_26130) | 1362152..1362445 | - | 294 | WP_010967243.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | Toxin |
| QC756_RS26135 (QC756_26135) | 1362442..1362750 | - | 309 | WP_010967242.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| QC756_RS26140 (QC756_26140) | 1362945..1363364 | - | 420 | WP_268814887.1 | plasmid partitioning protein RepB C-terminal domain-containing protein | - |
| QC756_RS26145 (QC756_26145) | 1363246..1363515 | - | 270 | WP_201271733.1 | plasmid partitioning protein RepB C-terminal domain-containing protein | - |
| QC756_RS26150 (QC756_26150) | 1363512..1363880 | - | 369 | WP_028005933.1 | ParB/RepB/Spo0J family partition protein | - |
| QC756_RS26155 (QC756_26155) | 1364019..1364219 | + | 201 | Protein_1339 | hypothetical protein | - |
| QC756_RS26160 (QC756_26160) | 1364250..1364609 | + | 360 | WP_040120590.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| QC756_RS26165 (QC756_26165) | 1364599..1364922 | + | 324 | WP_003526806.1 | DNA-binding transcriptional regulator | - |
| QC756_RS26170 (QC756_26170) | 1365113..1366639 | - | 1527 | WP_040120589.1 | amidohydrolase | - |
| QC756_RS26175 (QC756_26175) | 1366636..1367574 | - | 939 | WP_014532024.1 | nucleoside hydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | htpB | 1..1592319 | 1592319 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11278.93 Da Isoelectric Point: 6.4734
>T278344 WP_010967243.1 NZ_CP123005:c1362445-1362152 [Sinorhizobium meliloti]
MRLVWARYALDDRDTIFSYIERENPRAAVHVDEEIVSAVRRLLDFPESGRPGRIAGTRELVIPRTPYIAAYMVMEDRIRI
LRVLHGAQKWPSELDDG
MRLVWARYALDDRDTIFSYIERENPRAAVHVDEEIVSAVRRLLDFPESGRPGRIAGTRELVIPRTPYIAAYMVMEDRIRI
LRVLHGAQKWPSELDDG
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|