278342

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE(toxin)
Location 1021147..1021646 Replicon plasmid pSme442-SymA
Accession NZ_CP123005
Organism Sinorhizobium meliloti strain BIM B-442D

Toxin (Protein)


Gene name relE Uniprot ID Q92YA6
Locus tag QC756_RS24355 Protein ID WP_010967939.1
Coordinates 1021147..1021320 (-) Length 58 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A843ZXX9
Locus tag QC756_RS24360 Protein ID WP_014990215.1
Coordinates 1021317..1021646 (-) Length 110 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QC756_RS24330 (QC756_24330) 1017011..1018327 + 1317 WP_013845634.1 aspartate aminotransferase family protein -
QC756_RS24335 (QC756_24335) 1018706..1019191 - 486 WP_010967936.1 YidB family protein -
QC756_RS24340 (QC756_24340) 1019219..1019470 - 252 WP_003534243.1 GlsB/YeaQ/YmgE family stress response membrane protein -
QC756_RS24345 (QC756_24345) 1020065..1020424 + 360 WP_013845635.1 VOC family protein -
QC756_RS24350 (QC756_24350) 1020744..1021049 + 306 WP_013845638.1 hypothetical protein -
QC756_RS24355 (QC756_24355) 1021147..1021320 - 174 WP_010967939.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QC756_RS24360 (QC756_24360) 1021317..1021646 - 330 WP_014990215.1 hypothetical protein Antitoxin
QC756_RS24365 (QC756_24365) 1021581..1021766 + 186 WP_013845639.1 hypothetical protein -
QC756_RS24370 (QC756_24370) 1022556..1023300 + 745 Protein_982 alpha/beta hydrolase -
QC756_RS24375 (QC756_24375) 1023684..1024025 + 342 Protein_983 hypothetical protein -
QC756_RS24380 (QC756_24380) 1024009..1024347 - 339 WP_013845641.1 SDR family oxidoreductase -
QC756_RS24385 (QC756_24385) 1024464..1024907 - 444 WP_010967942.1 PACE efflux transporter -
QC756_RS24390 (QC756_24390) 1024999..1025892 + 894 WP_010967943.1 LysR family transcriptional regulator -
QC756_RS24395 (QC756_24395) 1026018..1026194 - 177 WP_013845643.1 hypothetical protein -
QC756_RS24400 (QC756_24400) 1026274..1026618 - 345 WP_013845644.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - htpB 1..1592319 1592319


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 58 a.a.        Molecular weight: 6497.32 Da        Isoelectric Point: 5.7733

>T278342 WP_010967939.1 NZ_CP123005:c1021320-1021147 [Sinorhizobium meliloti]
MKLVWARYALDDRDAIFSYIERENPRAAVHVDEEVVSAGRPLDFPESRRPGRIAGTP

Download         Length: 174 bp

Antitoxin


Download         Length: 110 a.a.        Molecular weight: 12067.72 Da        Isoelectric Point: 11.1401

>AT278342 WP_014990215.1 NZ_CP123005:c1021646-1021317 [Sinorhizobium meliloti]
VSERLLLIALLALGPFRASQRHTGRPALLRRGPQTAAGAVEEHFIQLRAPLWLITLGGFSHREAHDAWFRAKVLRALEDT
RPDADDADADAHFQERRAAALRKAAAGDR

Download         Length: 330 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q92YA6

Antitoxin

Source ID Structure
AlphaFold DB A0A843ZXX9

References