Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 556416..557101 | Replicon | plasmid pSme442-SymA |
Accession | NZ_CP123005 | ||
Organism | Sinorhizobium meliloti strain BIM B-442D |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | QC756_RS22125 | Protein ID | WP_010967510.1 |
Coordinates | 556416..556835 (-) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | QC756_RS22130 | Protein ID | WP_041169972.1 |
Coordinates | 556832..557101 (-) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QC756_RS22105 (QC756_22105) | 551623..552327 | + | 705 | WP_014528617.1 | autoinducer binding domain-containing protein | - |
QC756_RS22110 (QC756_22110) | 552351..553004 | - | 654 | Protein_530 | ISNCY family transposase | - |
QC756_RS22115 (QC756_22115) | 553396..554769 | - | 1374 | WP_014528618.1 | ISNCY family transposase | - |
QC756_RS22120 (QC756_22120) | 554895..555895 | - | 1001 | Protein_532 | IS30 family transposase | - |
QC756_RS22125 (QC756_22125) | 556416..556835 | - | 420 | WP_010967510.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QC756_RS22130 (QC756_22130) | 556832..557101 | - | 270 | WP_041169972.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
QC756_RS22135 (QC756_22135) | 557237..557410 | + | 174 | Protein_535 | LysR substrate-binding domain-containing protein | - |
QC756_RS22140 (QC756_22140) | 557476..558351 | - | 876 | WP_015445434.1 | LysR family transcriptional regulator | - |
QC756_RS22145 (QC756_22145) | 559361..559531 | + | 171 | WP_162471696.1 | hypothetical protein | - |
QC756_RS22150 (QC756_22150) | 560107..560238 | + | 132 | WP_267901517.1 | hypothetical protein | - |
QC756_RS22155 (QC756_22155) | 560295..560675 | - | 381 | WP_010967516.1 | transcriptional regulator | - |
QC756_RS22160 (QC756_22160) | 560693..561004 | - | 312 | WP_003526630.1 | type II toxin-antitoxin system HigB family toxin | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | htpB | 1..1592319 | 1592319 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 14785.05 Da Isoelectric Point: 4.8837
>T278341 WP_010967510.1 NZ_CP123005:c556835-556416 [Sinorhizobium meliloti]
VSRLYMLDTNIVSELARNPQGAVTKRIAEVGPEAVCVSIITAAELRYGCAKKGSPKLLAQIEAILGSMQVLALDVPADAE
YGNIRAELETAGKPIGPNDLFIAAHACVLGAVLVTVNSSEFTRVRDLKVENWLDFTSSG
VSRLYMLDTNIVSELARNPQGAVTKRIAEVGPEAVCVSIITAAELRYGCAKKGSPKLLAQIEAILGSMQVLALDVPADAE
YGNIRAELETAGKPIGPNDLFIAAHACVLGAVLVTVNSSEFTRVRDLKVENWLDFTSSG
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|